SitesBLAST
Comparing 17502 FitnessBrowser__Keio:17502 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2vi7C Structure of a putative acetyltransferase (pa1377)from pseudomonas aeruginosa (see paper)
40% identity, 96% coverage: 7:162/162 of query aligns to 8:164/165 of 2vi7C
2ge3A Crystal structure of probable acetyltransferase from agrobacterium tumefaciens
37% identity, 66% coverage: 53:159/162 of query aligns to 55:160/164 of 2ge3A
- binding acetyl coenzyme *a: M86 (≠ I84), G87 (≠ C85), I88 (≠ V86), R93 (≠ K91), N94 (= N92), G96 (= G94), G98 (≠ A96), A99 (≠ S97), S120 (≠ T119), V121 (= V120), N125 (= N124), R127 (≠ P126), A128 (= A127), A130 (≠ K129), L131 (≠ V130), Y132 (= Y131), K134 (= K133)
Sites not aligning to the query:
2i79A The crystal structure of the acetyltransferase of gnat family from streptococcus pneumoniae
34% identity, 67% coverage: 54:161/162 of query aligns to 62:170/171 of 2i79A
- binding acetyl coenzyme *a: F91 (≠ G83), I92 (= I84), V93 (≠ C85), I94 (≠ V86), W99 (≠ K91), N100 (= N92), G102 (= G94), G104 (≠ A96), S105 (= S97), L126 (= L118), Q133 (≠ A125), A134 (≠ P126), H137 (≠ K129), Y139 (= Y131)
Sites not aligning to the query:
5c88A Crystal structure of ard1 n-terminal acetyltransferase from sulfolobus solfataricus in monoclinic form (see paper)
29% identity, 98% coverage: 3:160/162 of query aligns to 1:155/158 of 5c88A
- binding coenzyme a: I82 (= I84), V84 (= V86), R89 (≠ K91), R90 (≠ N92), G92 (= G94), A94 (= A96), T95 (≠ S97), N122 (= N124), P124 (= P126), A125 (= A127), A127 (≠ K129), L128 (≠ V130)
4r3lA Crystal structure of ard1 n-terminal acetyltransferase from sulfolobus solfataricus bound to substrate peptide fragment and coa (see paper)
29% identity, 98% coverage: 3:160/162 of query aligns to 1:155/157 of 4r3lA
- binding coenzyme a: L23 (≠ Q23), I82 (= I84), A83 (≠ C85), V84 (= V86), R89 (≠ K91), R90 (≠ N92), G92 (= G94), I93 (≠ V95), A94 (= A96), T95 (≠ S97), N122 (= N124), Y123 (≠ A125), P124 (= P126), L128 (≠ V130), Y129 (= Y131), K131 (= K133)
- binding : E25 (= E25), Y27 (= Y27), H78 (= H78), V80 (≠ A80), E117 (≠ T119), Y143 (= Y145), Y144 (≠ L147)
4r3kA Crystal structure of ard1 n-terminal acetyltransferase from sulfolobus solfataricus bound to coa (see paper)
29% identity, 98% coverage: 3:160/162 of query aligns to 1:155/157 of 4r3kA
- binding calcium ion: V118 (= V120), R119 (≠ F121), N122 (= N124)
- binding coenzyme a: L23 (≠ Q23), I82 (= I84), A83 (≠ C85), V84 (= V86), R89 (≠ K91), R90 (≠ N92), G92 (= G94), A94 (= A96), T95 (≠ S97), Y123 (≠ A125), P124 (= P126), L128 (≠ V130), Y129 (= Y131)
4lx9A Archaeal amino-terminal acetyltransferase (nat) bound to acetyl coenzyme a (see paper)
29% identity, 98% coverage: 3:160/162 of query aligns to 1:155/157 of 4lx9A
- binding acetyl coenzyme *a: L23 (≠ Q23), I82 (= I84), V84 (= V86), R89 (≠ K91), R90 (≠ N92), G92 (= G94), A94 (= A96), T95 (≠ S97), E117 (≠ T119), P124 (= P126), L128 (≠ V130), Y129 (= Y131), K131 (= K133)
- binding zinc ion: H78 (= H78), E117 (≠ T119)
Q980R9 N-alpha-acetyltransferase; NAT; Amino-terminal acetyltransferase; N-terminal acetyltransferase; EC 2.3.1.255; EC 2.3.1.258 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see 4 papers)
29% identity, 98% coverage: 3:160/162 of query aligns to 11:165/167 of Q980R9
- L33 (≠ Q23) mutation to A: 20- and 2-fold decrease of the catalytic efficiency and affinity for Ser-N-terminal peptide. 11-fold decrease of the catalytic efficiency for Met-N-terminal peptide, but almost same affinity compared to the wild-type.
- P34 (= P24) mutation to A: 20-fold decrease of the catalytic efficiency for Ser-N-terminal peptide, but almost same affinity compared to the wild-type. 18-fold decrease of the catalytic efficiency for Met-N-terminal peptide, but almost same affinity compared to the wild-type.
- E35 (= E25) Plays an important role in substrate specificity; mutation to A: Slight increase of the catalytic efficiency for Ser-N-terminal peptide, but 4-fold decrease of the affinity compared to the wild-type. 6-fold increase of the catalytic efficiency for Met-N-terminal peptide and slight decrease of the affinity compared to the wild-type.; mutation to F: Strong decrease of the acetyltransferase activity with Ser-N-terminal peptide such as Alba. 2-fold increase of acetyltransferase activity for Ala-N-terminal peptide such as Hjc compared to the wild-type.; mutation to Q: Loss of acetyltransferase activity for Ser and Met-N-terminal peptide; when associated with Gln-127.; mutation to V: Alters the N-terminal substrate specificity and allows large N-terminal end residue of the substrate to be accommodated in a substrate-binding pocket. 4-fold increase of the acetyltransferase activity with Met-N-terminal peptide such as SSB compared to the wild-type. 2-fold increase of acetyltransferase activity with Ala-N-terminal peptide such as Hjc.; mutation to W: Low acetyltransferase activity with Ala-, Met- and Ser-N-terminal peptide.
- Y37 (= Y27) binding ; mutation to A: 34-fold decrease of the catalytic efficiency for Ser-N-terminal peptide and slight decrease of the affinity compared to the wild-type. Loss of acetyltransferase activity for Met-N-terminal peptide.; mutation to F: Same catalytic efficiency and slight decrease of the affinity for Ser-N-terminal peptide compared to the wild-type. 3-fold decrease of the catalytic efficiency and 1.3-fold increase of the affinity for Met-N-terminal peptide compared to the wild-type.
- S75 (≠ I68) Plays an important role in modulating multiple conformations of loop regions and contributes to protein thermostability; mutation to A: Has a melting temperature about 3 degrees Celsius lower than that of the wild-type.
- S82 (vs. gap) Plays an important role in modulating multiple conformations of loop regions and contributes to protein thermostability; mutation to A: Has a melting temperature about 3 degrees Celsius lower than that of the wild-type.
- H88 (= H78) binding ; mutation to A: 2.5- and 1.5-fold decrease of the catalytic efficiency and affinity for Ser-N-terminal peptide compared to the wild-type, respectively. Loss of acetyltransferase activity for Met-N-terminal peptide.; mutation to F: 2.5-fold decrease of the catalytic efficiency for Ser-N-terminal peptide, but almost same affinity compared to the wild-type. Loss of acetyltransferase activity for Met-N-terminal peptide.; mutation to Q: 2.5-fold decrease of the catalytic efficiency for Ser-N-terminal peptide, but 1.5-fold increase of the affinity compared to the wild-type. Loss of acetyltransferase activity for Met-N-terminal peptide.
- IAV 92:94 (≠ ICV 84:86) binding
- R100 (≠ N92) mutation to A: 7-fold decrease of the affinity, with no significant difference in the catalytic efficiency. Same fold compared to the wild-type.
- RKGIAT 100:105 (≠ NRGVAS 92:97) binding
- T105 (≠ S97) mutation to A: 3-fold decrease of the affinity, with no significant difference in the catalytic efficiency. Same fold compared to the wild-type.
- Y125 (≠ E117) mutation to A: Same catalytic efficiency and 1.7-fold decrease of the affinity for Ser-N-terminal peptide compared to the wild-type. 1.5- and 2.5-fold decrease of the catalytic efficiency and affinity for Met-N-terminal peptide compared to the wild-type, respectively.
- E127 (≠ T119) binding ; mutation to A: Same catalytic efficiency and slight decrease of the affinity for Ser-N-terminal peptide compared to the wild-type. Loss of acetyltransferase activity for Met-N-terminal peptide.; mutation to H: 1.3-fold decrease of the catalytic efficiency for Ser-N-terminal peptide, but almost same affinity compared to the wild-type. 1.7-fold decrease of the catalytic efficiency and 1.3-fold increase of the affinity for Met-N-terminal peptide compared to the wild-type.; mutation to Q: 2.3-fold decrease of the catalytic efficiency and 1.3-fold increase of the affinity for Ser-N-terminal peptide compared to the wild-type. 5-fold decrease of the catalytic efficiency and slight decrease of the affinity for Met-N-terminal peptide compared to the wild-type. Loss of acetyltransferase activity for Ser and Met-N-terminal peptide; when associated with Gln-35.
- R129 (≠ F121) mutation to A: Slight decrease of the catalytic efficiency and of the affinity for Ser-N-terminal peptide compared to teh wild-type. 2.5-fold increase of the catalytic efficiency and almost the same affinity for Met-N-terminal peptide compared to the wild-type.
- N132 (= N124) binding ; mutation to A: 4.5-fold decrease of the affinity, with no significant difference in the catalytic efficiency. Same fold compared to the wild-type.
- YEK 139:141 (≠ YKK 131:133) binding
- Y154 (≠ L147) binding ; mutation to A: 1.3-fold decrease of the catalytic efficiency for Ser-N-terminal peptide, but same affinity compared to the wild-type. 6.5-fold decrease of the catalytic efficiency for Met-N-terminal peptide, but same affinity compared to the wild-type.; mutation to F: Almost same catalytic efficiency for Ser-N-terminal peptide and slight decrease of the affinity compared to the wild-type. 5-fold decrease of the catalytic efficiency for Met-N-terminal peptide and 1.5-fold decrease of the affinity compared to the wild-type.
4pv6G Crystal structure analysis of ard1 from thermoplasma volcanium (see paper)
35% identity, 67% coverage: 54:161/162 of query aligns to 48:148/154 of 4pv6G
- binding acetyl coenzyme *a: L73 (≠ F82), F75 (≠ I84), V77 (= V86), R82 (≠ K91), R83 (≠ N92), G85 (= G94), G87 (≠ A96), S88 (= S97), E116 (≠ P126), R119 (≠ K129), F120 (≠ V130), Y121 (= Y131)
Sites not aligning to the query:
4pv6A Crystal structure analysis of ard1 from thermoplasma volcanium (see paper)
35% identity, 67% coverage: 54:161/162 of query aligns to 48:148/154 of 4pv6A
- binding coenzyme a: L73 (≠ F82), L74 (≠ G83), F75 (≠ I84), V77 (= V86), R82 (≠ K91), R83 (≠ N92), G85 (= G94), G87 (≠ A96), S88 (= S97), N114 (= N124), E116 (≠ P126), F120 (≠ V130), Y121 (= Y131)
6d72B Crystal structure of spermidine/spermine n-acetyltransferase speg from yersinia pestis in complex with calcium ions.
37% identity, 45% coverage: 80:152/162 of query aligns to 85:157/176 of 6d72B
Sites not aligning to the query:
3ld2B The crystal structure of smu.2055 from streptococcus mutans ua159
30% identity, 62% coverage: 54:154/162 of query aligns to 51:150/162 of 3ld2B
- binding coenzyme a: I82 (= I84), V84 (= V86), R89 (≠ K91), R90 (≠ N92), G92 (= G94), G94 (≠ A96), R95 (= R101), E122 (≠ P126), A123 (= A127), L125 (≠ K129), F126 (≠ V130), K129 (= K133)
Sites not aligning to the query:
6c37A Mycobacterium smegmatis rimj in complex with coa-disulfide
34% identity, 63% coverage: 58:159/162 of query aligns to 86:186/209 of 6c37A
- binding [[(2~{S},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(3~{R})-4-[[3-[2-[2-[3-[[(2~{R})-4-[[[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-4-oxidanyl-3-phosphonooxy-oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-3,3-dimethyl-2-oxidanyl-butanoyl]amino]propanoylamino]ethyldisulfanyl]ethylamino]-3-oxidanylidene-propyl]amino]-2,2-dimethyl-3-oxidanyl-4-oxidanylidene-butyl] hydrogen phosphate: G110 (= G83), Y111 (≠ I84), W112 (≠ C85), V113 (= V86), T118 (≠ K91), G119 (≠ N92), G121 (= G94), A123 (= A96), T124 (≠ S97), T146 (= T119), N151 (= N124), T152 (≠ A125), P153 (= P126), S154 (≠ A127), V157 (= V130), H160 (≠ K133)
Sites not aligning to the query:
6c32A Mycobacterium smegmatis rimj with accoa
34% identity, 63% coverage: 58:159/162 of query aligns to 86:186/209 of 6c32A
- binding acetyl coenzyme *a: G110 (= G83), Y111 (≠ I84), W112 (≠ C85), V113 (= V86), T118 (≠ K91), G119 (≠ N92), G121 (= G94), A123 (= A96), T124 (≠ S97), T146 (= T119), N151 (= N124), T152 (≠ A125), P153 (= P126), S154 (≠ A127), V157 (= V130), H160 (≠ K133)
Sites not aligning to the query:
6wfgA Crystal structure of human naa50 in complex with an inhibitor (compound 3) identified using DNA encoded library technology (see paper)
30% identity, 50% coverage: 68:148/162 of query aligns to 59:137/150 of 6wfgA
- binding coenzyme a: L73 (≠ F82), G74 (= G83), C75 (= C85), R80 (≠ K91), R81 (≠ N92), G83 (= G94), G85 (≠ A96), T86 (≠ S97), N113 (= N124), S115 (≠ P126), D118 (≠ K129), F119 (≠ V130), K122 (= K133)
- binding (2S)-N-[(2S)-3-[1-(3-tert-butyl-1-methyl-1H-pyrazole-5-carbonyl)piperidin-4-yl]-1-(methylamino)-1-oxopropan-2-yl]-6-oxopiperidine-2-carboxamide: D60 (= D69), Y69 (≠ H78), M71 (≠ A80), Y106 (≠ E117), H108 (≠ T119), Q110 (≠ F121), Y134 (= Y145), Y135 (≠ A146)
Sites not aligning to the query:
6wfoA Crystal structure of human naa50 in complex with accoa and an inhibitor (compound 4b) identified using DNA encoded library technology (see paper)
30% identity, 50% coverage: 68:148/162 of query aligns to 62:140/153 of 6wfoA
- binding acetyl coenzyme *a: I73 (≠ V79), M74 (≠ A80), T75 (≠ D81), L76 (≠ F82), G77 (= G83), C78 (= C85), R83 (≠ K91), R84 (≠ N92), G86 (= G94), G88 (≠ A96), T89 (≠ S97), N116 (= N124), S118 (≠ P126), A119 (= A127), F122 (≠ V130), K125 (= K133)
- binding (4S)-1-methyl-N-{(3S,5R)-5-[4-(methylcarbamoyl)-1,3-thiazol-2-yl]-1-[4-(1H-tetrazol-5-yl)benzene-1-carbonyl]pyrrolidin-3-yl}-2,6-dioxohexahydropyrimidine-4-carboxamide: Y72 (≠ H78), M74 (≠ A80), H111 (≠ T119), Y137 (= Y145), Y138 (≠ A146), K139 (≠ L147), R140 (= R148)
Sites not aligning to the query:
6wfkA Crystal structure of human naa50 in complex with coa and an inhibitor (compound 4a) identified using DNA encoded library technology (see paper)
30% identity, 50% coverage: 68:148/162 of query aligns to 62:140/153 of 6wfkA
- binding coenzyme a: L76 (≠ F82), G77 (= G83), C78 (= C85), R83 (≠ K91), R84 (≠ N92), G86 (= G94), G88 (≠ A96), T89 (≠ S97), N116 (= N124), S118 (≠ P126), F122 (≠ V130), K125 (= K133)
- binding (4S)-1-methyl-N-{(3S,5S)-5-[4-(methylcarbamoyl)-1,3-thiazol-2-yl]-1-[4-(1H-tetrazol-5-yl)benzene-1-carbonyl]pyrrolidin-3-yl}-2,6-dioxohexahydropyrimidine-4-carboxamide: Y72 (≠ H78), M74 (≠ A80), H111 (≠ T119), Q113 (≠ F121), Y137 (= Y145), Y138 (≠ A146), K139 (≠ L147), R140 (= R148)
Sites not aligning to the query:
2ob0C Human mak3 homolog in complex with acetyl-coa
30% identity, 50% coverage: 68:148/162 of query aligns to 60:138/166 of 2ob0C
- binding acetyl coenzyme *a: L74 (≠ F82), G75 (= G83), R81 (≠ K91), R82 (≠ N92), G84 (= G94), G86 (≠ A96), T87 (≠ S97), N114 (= N124), S116 (≠ P126), A117 (= A127), D119 (≠ K129), F120 (≠ V130)
Sites not aligning to the query:
6wf5A Crystal structure of human naa50 in complex with a truncated cofactor derived inhibitor (compound 2) (see paper)
30% identity, 50% coverage: 68:148/162 of query aligns to 59:137/165 of 6wf5A
- binding (2R)-2-hydroxy-3,3-dimethyl-N-{3-oxo-3-[(2-sulfanylethyl)amino]propyl}butanamide: L73 (≠ F82), G74 (= G83), C75 (= C85), R80 (≠ K91), F119 (≠ V130), Y120 (= Y131)
- binding : M71 (≠ A80), H108 (≠ T119), Y134 (= Y145), Y135 (≠ A146), K136 (≠ L147)
Sites not aligning to the query:
3tfyA Naa50p amino-terminal acetyltransferase bound to substrate peptide fragment and coa (see paper)
30% identity, 50% coverage: 68:148/162 of query aligns to 63:141/155 of 3tfyA
- binding coenzyme a: L77 (≠ F82), G78 (= G83), C79 (= C85), R84 (≠ K91), R85 (≠ N92), G87 (= G94), G89 (≠ A96), T90 (≠ S97), N117 (= N124), S119 (≠ P126), D122 (≠ K129), F123 (≠ V130), Y124 (= Y131), K126 (= K133)
- binding : Y73 (≠ H78), M75 (≠ A80), H112 (≠ T119), Y139 (≠ A146)
Sites not aligning to the query:
Query Sequence
>17502 FitnessBrowser__Keio:17502
MSEIVIRHAETRDYEAIRQIHAQPEVYCNTLQVPHPSDHMWQERLADRPGIKQLVACIDG
DVVGHLTIDVQQRPRRSHVADFGICVDSRWKNRGVASALMREMIEMCDNWLRVDRIELTV
FVDNAPAIKVYKKYGFEIEGTGKKYALRNGEYVDAYYMARVK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory