Comparing 17519 FitnessBrowser__Keio:17519 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1uskA L-leucine-binding protein with leucine bound (see paper)
100% identity, 93% coverage: 24:368/369 of query aligns to 1:345/345 of 1uskA
1usiA L-leucine-binding protein with phenylalanine bound (see paper)
100% identity, 93% coverage: 24:368/369 of query aligns to 1:345/345 of 1usiA
1z18A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound valine (see paper)
79% identity, 94% coverage: 24:369/369 of query aligns to 1:344/344 of 1z18A
1z17A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound ligand isoleucine (see paper)
79% identity, 94% coverage: 24:369/369 of query aligns to 1:344/344 of 1z17A
1z16A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound leucine (see paper)
79% identity, 94% coverage: 24:369/369 of query aligns to 1:344/344 of 1z16A
4n0qB Crystal structure of an abc transporter, substrate-binding protein from brucella melitensis 16m in complex with l-leucine using a crystal grown in a crystal former (microlytic)
40% identity, 91% coverage: 25:359/369 of query aligns to 2:337/345 of 4n0qB
3ip9A Structure of atu2422-gaba receptor in complex with gaba (see paper)
41% identity, 91% coverage: 25:359/369 of query aligns to 2:335/348 of 3ip9A
3ip7A Structure of atu2422-gaba receptor in complex with valine (see paper)
41% identity, 91% coverage: 25:359/369 of query aligns to 2:335/348 of 3ip7A
3ip6A Structure of atu2422-gaba receptor in complex with proline (see paper)
41% identity, 91% coverage: 25:359/369 of query aligns to 2:335/348 of 3ip6A
3ip5A Structure of atu2422-gaba receptor in complex with alanine (see paper)
41% identity, 91% coverage: 25:359/369 of query aligns to 2:335/348 of 3ip5A
3ipcA Structure of atu2422-gaba f77a mutant receptor in complex with leucine (see paper)
41% identity, 91% coverage: 25:359/369 of query aligns to 2:335/348 of 3ipcA
4mlcA Abc transporter substrate-binding protein fromdesulfitobacterium hafniense
32% identity, 85% coverage: 37:348/369 of query aligns to 10:317/336 of 4mlcA
4q6bA Crystal structure of abc transporter substrate-binding protein fromdesulfitobacterium hafniense complex with leu
31% identity, 85% coverage: 37:348/369 of query aligns to 10:316/335 of 4q6bA
3td9A Crystal structure of a leucine binding protein livk (tm1135) from thermotoga maritima msb8 at 1.90 a resolution
28% identity, 88% coverage: 26:348/369 of query aligns to 2:324/350 of 3td9A
4gnrA 1.0 angstrom resolution crystal structure of the branched-chain amino acid transporter substrate binding protein livj from streptococcus pneumoniae str. Canada mdr_19a in complex with isoleucine
30% identity, 61% coverage: 26:250/369 of query aligns to 3:225/348 of 4gnrA
Sites not aligning to the query:
4q6wA Crystal structure of periplasmic binding protein type 1 from bordetella pertussis tohama i complexed with 3-hydroxy benzoic acid
24% identity, 85% coverage: 23:336/369 of query aligns to 1:341/376 of 4q6wA
3i45A Crystal structure of putative twin-arginine translocation pathway signal protein from rhodospirillum rubrum atcc 11170
26% identity, 80% coverage: 47:342/369 of query aligns to 25:327/378 of 3i45A
4ms1A Crystal structure of the extracellular domain of human gaba(b) receptor bound to the antagonist cgp46381 (see paper)
25% identity, 39% coverage: 52:194/369 of query aligns to 31:175/407 of 4ms1A
Sites not aligning to the query:
4mrmA Crystal structure of the extracellular domain of human gaba(b) receptor bound to the antagonist phaclofen (see paper)
25% identity, 39% coverage: 52:194/369 of query aligns to 31:175/407 of 4mrmA
Sites not aligning to the query:
4mr9A Crystal structure of the extracellular domain of human gaba(b) receptor bound to the antagonist sch50911 (see paper)
25% identity, 39% coverage: 52:194/369 of query aligns to 31:175/407 of 4mr9A
Sites not aligning to the query:
>17519 FitnessBrowser__Keio:17519
MKRNAKTIIAGMIALAISHTAMADDIKVAVVGAMSGPIAQWGDMEFNGARQAIKDINAKG
GIKGDKLVGVEYDDACDPKQAVAVANKIVNDGIKYVIGHLCSSSTQPASDIYEDEGILMI
SPGATNPELTQRGYQHIMRTAGLDSSQGPTAAKYILETVKPQRIAIIHDKQQYGEGLARS
VQDGLKAANANVVFFDGITAGEKDFSALIARLKKENIDFVYYGGYYPEMGQMLRQARSVG
LKTQFMGPEGVGNASLSNIAGDAAEGMLVTMPKRYDQDPANQGIVDALKADKKDPSGPYV
WITYAAVQSLATALERTGSDEPLALVKDLKANGANTVIGPLNWDEKGDLKGFDFGVFQWH
ADGSSTAAK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory