Comparing 17584 b3523 predicted transporter (NCBI) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 5 hits to proteins with known functional sites (download)
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
26% identity, 53% coverage: 4:236/440 of query aligns to 13:233/444 of Q8NLB7
Sites not aligning to the query:
P36035 Carboxylic acid transporter protein homolog from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
26% identity, 83% coverage: 77:440/440 of query aligns to 188:563/616 of P36035
Sites not aligning to the query:
8bw7A Cryo-em structure of rat slc22a6 bound to alpha-ketoglutaric acid (see paper)
23% identity, 74% coverage: 79:402/440 of query aligns to 129:448/497 of 8bw7A
8bvsA Cryo-em structure of rat slc22a6 bound to tenofovir (see paper)
23% identity, 74% coverage: 79:402/440 of query aligns to 129:452/502 of 8bvsA
8bvtA Cryo-em structure of rat slc22a6 bound to probenecid (see paper)
23% identity, 74% coverage: 79:402/440 of query aligns to 138:461/508 of 8bvtA
Sites not aligning to the query:
>17584 b3523 predicted transporter (NCBI)
MQATATTLDHEQEYTPINSRNKVLVASLIGTAIEFFDFYIYATAAVIVFPHIFFPQGDPT
AATLQSLATFAIAFVARPIGSAVFGHFGDRVGRKATLVASLLTMGISTVVIGLLPGYATI
GIFAPLLLALARFGQGLGLGGEWGGAALLATENAPPRKRALYGSFPQLGAPIGFFFANGT
FLLLSWLLTDEQFMSWGWRVPFIFSAVLVIIGLYVRVSLHESPVFEKVAKAKKQVKIPLG
TLLTKHVRVTVLGTFIMLATYTLFYIMTVYSMTFSTAAAPVGLGLPRNEVLWMLMMAVIG
FGVMVPVAGLLADAFGRRKSMVIITTLIILFALFAFNPLLGSGNPILVFAFLLLGLSLMG
LTFGPMGALLPELFPTEVRYTGASFSYNVASILGASVAPYIAAWLQTNYGLGAVGLYLAA
MAGLTLIALLLTHETRHQSL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory