Comparing 17587 FitnessBrowser__Keio:17587 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ebuA Crystal structure of a sugar kinase (target efi-502312) from oceanicola granulosus, with bound amp/adp crystal form i
37% identity, 97% coverage: 4:302/309 of query aligns to 16:304/306 of 4ebuA
4eumA Crystal structure of a sugar kinase (target efi-502132) from oceanicola granulosus with bound amp, crystal form ii
36% identity, 95% coverage: 4:296/309 of query aligns to 16:294/294 of 4eumA
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
31% identity, 88% coverage: 27:299/309 of query aligns to 33:286/300 of 1v1bA
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
31% identity, 88% coverage: 27:299/309 of query aligns to 33:286/301 of 1v1aA
Sites not aligning to the query:
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
31% identity, 88% coverage: 27:299/309 of query aligns to 33:286/309 of Q53W83
Sites not aligning to the query:
Q8ZKR2 Aminoimidazole riboside kinase; AIRs kinase; EC 2.7.1.223 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
26% identity, 87% coverage: 3:271/309 of query aligns to 5:259/319 of Q8ZKR2
Sites not aligning to the query:
3in1A Crystal structure of a putative ribokinase in complex with adp from e.Coli
28% identity, 89% coverage: 27:300/309 of query aligns to 39:294/312 of 3in1A
1tz3A Crystal structure of aminoimidazole riboside kinase complexed with aminoimidazole riboside (see paper)
26% identity, 87% coverage: 3:271/309 of query aligns to 1:248/299 of 1tz3A
1tz6A Crystal structure of aminoimidazole riboside kinase from salmonella enterica complexed with aminoimidazole riboside and atp analog (see paper)
26% identity, 87% coverage: 3:271/309 of query aligns to 1:248/297 of 1tz6A
Sites not aligning to the query:
5eynA Crystal structure of fructokinase from vibrio cholerae o395 in fructose, adp, beryllium trifluoride and calcium ion bound form
25% identity, 87% coverage: 4:271/309 of query aligns to 3:256/306 of 5eynA
Sites not aligning to the query:
Q97U29 2-dehydro-3-deoxygluconokinase/2-dehydro-3-deoxygalactonokinase; 2-dehydro-3-deoxyglucono/galactono-kinase; 2-keto-3-deoxy-galactonokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; KDGal kinase; EC 2.7.1.178 from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
23% identity, 90% coverage: 23:299/309 of query aligns to 29:293/313 of Q97U29
Sites not aligning to the query:
2varA Crystal structure of sulfolobus solfataricus 2-keto-3-deoxygluconate kinase complexed with 2-keto-3-deoxygluconate (see paper)
23% identity, 90% coverage: 23:299/309 of query aligns to 28:292/311 of 2varA
Sites not aligning to the query:
3lkiB Crystal structure of fructokinase with bound atp from xylella fastidiosa
26% identity, 88% coverage: 1:271/309 of query aligns to 1:260/322 of 3lkiB
Sites not aligning to the query:
3ih0A Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with amp-pnp
26% identity, 87% coverage: 5:272/309 of query aligns to 3:254/304 of 3ih0A
Sites not aligning to the query:
A1A6H3 Ribokinase; AtRBSK; RK; EC 2.7.1.15 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
34% identity, 30% coverage: 210:301/309 of query aligns to 273:362/379 of A1A6H3
Sites not aligning to the query:
3gbuA Crystal structure of an uncharacterized sugar kinase ph1459 from pyrococcus horikoshii in complex with atp
26% identity, 87% coverage: 5:272/309 of query aligns to 2:253/302 of 3gbuA
Sites not aligning to the query:
6ilsB Structure of arabidopsis thaliana ribokinase complexed with ribose and atp (see paper)
34% identity, 30% coverage: 210:301/309 of query aligns to 207:296/313 of 6ilsB
Sites not aligning to the query:
3iq0B Crystal structure of a putative ribokinase ii in complex with atp and mg+2 from e.Coli
24% identity, 85% coverage: 40:301/309 of query aligns to 44:292/308 of 3iq0B
7fcaD Pfkb(mycobacterium marinum) (see paper)
27% identity, 86% coverage: 7:271/309 of query aligns to 6:237/282 of 7fcaD
3ktnA Crystal structure of a putative 2-keto-3-deoxygluconate kinase from enterococcus faecalis
27% identity, 69% coverage: 2:213/309 of query aligns to 1:215/340 of 3ktnA
Sites not aligning to the query:
>17587 FitnessBrowser__Keio:17587
MSKKIAVIGECMIELSEKGADVKRGFGGDTLNTSVYIARQVDPAALTVHYVTALGTDSFS
QQMLDAWHGENVDTSLTQRMENRLPGLYYIETDSTGERTFYYWRNEAAAKFWLESEQSAA
ICEELANFDYLYLSGISLAILSPTSREKLLSLLRECRANGGKVIFDNNYRPRLWASKEET
QQVYQQMLECTDIAFLTLDDEDALWGQQPVEDVIARTHNAGVKEVVVKRGADSCLVSIAG
EGLVDVPAVKLPKEKVIDTTAAGDSFSAGYLAVRLTGGSAEDAAKRGHLTASTVIQYRGA
IIPREAMPA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory