Comparing 17589 FitnessBrowser__Keio:17589 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
30% identity, 91% coverage: 19:407/428 of query aligns to 26:421/425 of O59010
2nwwA Crystal structure of gltph in complex with tboa (see paper)
29% identity, 89% coverage: 19:400/428 of query aligns to 17:405/407 of 2nwwA
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
29% identity, 89% coverage: 19:400/428 of query aligns to 23:411/413 of 6x14A
Sites not aligning to the query:
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
29% identity, 89% coverage: 19:400/428 of query aligns to 26:414/419 of 6x15A
Sites not aligning to the query:
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
30% identity, 89% coverage: 19:400/428 of query aligns to 18:406/409 of 6bavA
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
30% identity, 89% coverage: 19:400/428 of query aligns to 18:406/408 of 6bauA
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
30% identity, 95% coverage: 5:409/428 of query aligns to 11:423/427 of 5e9sA
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
30% identity, 95% coverage: 5:409/428 of query aligns to 11:423/426 of 6xwnB
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
30% identity, 95% coverage: 5:409/428 of query aligns to 8:420/424 of 6zl4A
Sites not aligning to the query:
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
30% identity, 95% coverage: 5:409/428 of query aligns to 9:421/425 of 6zgbA
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
30% identity, 95% coverage: 5:409/428 of query aligns to 4:412/416 of 6r7rA
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
28% identity, 89% coverage: 19:400/428 of query aligns to 18:394/396 of 6bmiA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
30% identity, 92% coverage: 20:411/428 of query aligns to 33:407/412 of 7awmA
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
30% identity, 92% coverage: 20:411/428 of query aligns to 25:393/397 of 5mjuA
8oudA Structure of the human neutral amino acid transporter asct2 in complex with nanobody 469 (see paper)
30% identity, 83% coverage: 51:404/428 of query aligns to 58:415/416 of 8oudA
Q15758 Neutral amino acid transporter B(0); ATB(0); Baboon M7 virus receptor; RD114/simian type D retrovirus receptor; Sodium-dependent neutral amino acid transporter type 2; Solute carrier family 1 member 5 from Homo sapiens (Human) (see 2 papers)
29% identity, 85% coverage: 51:414/428 of query aligns to 106:498/541 of Q15758
Sites not aligning to the query:
7xr4A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with glutamate (see paper)
28% identity, 89% coverage: 27:406/428 of query aligns to 35:420/425 of 7xr4A
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
27% identity, 89% coverage: 27:406/428 of query aligns to 36:419/424 of 7xr6A
Sites not aligning to the query:
8ouhA Complex of human asct2 with syncytin-1 (see paper)
30% identity, 83% coverage: 51:404/428 of query aligns to 64:440/440 of 8ouhA
7bcsA Asct2 in the presence of the inhibitor lc-bpe (position "down") in the outward-open conformation. (see paper)
30% identity, 83% coverage: 51:404/428 of query aligns to 60:442/442 of 7bcsA
>17589 FitnessBrowser__Keio:17589
MKTSLFKSLYFQVLTAIAIGILLGHFYPEIGEQMKPLGDGFVKLIKMIIAPVIFCTVVTG
IAGMESMKAVGRTGAVALLYFEIVSTIALIIGLIIVNVVQPGAGMNVDPATLDAKAVAVY
ADQAKDQGIVAFIMDVIPASVIGAFASGNILQVLLFAVLFGFALHRLGSKGQLIFNVIES
FSQVIFGIINMIMRLAPIGAFGAMAFTIGKYGVGTLVQLGQLIICFYITCILFVVLVLGS
IAKATGFSIFKFIRYIREELLIVLGTSSSESALPRMLDKMEKLGCRKSVVGLVIPTGYSF
NLDGTSIYLTMAAVFIAQATNSQMDIVHQITLLIVLLLSSKGAAGVTGSGFIVLAATLSA
VGHLPVAGLALILGIDRFMSEARALTNLVGNGVATIVVAKWVKELDHKKLDDVLNNRAPD
GKTHELSS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory