SitesBLAST
Comparing 17626 FitnessBrowser__Keio:17626 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P00944 Xylose isomerase; D-xylulose keto-isomerase; EC 5.3.1.5 from Escherichia coli (strain K12) (see paper)
100% identity, 100% coverage: 1:440/440 of query aligns to 1:440/440 of P00944
- H101 (= H101) active site
1a0cA Xylose isomerase from thermoanaerobacterium thermosulfurigenes
51% identity, 99% coverage: 4:438/440 of query aligns to 3:436/437 of 1a0cA
- active site: H100 (= H101), D103 (= D104), W138 (= W139), E231 (= E232), K233 (= K234), E267 (= E268), H270 (= H271), D295 (= D296), D306 (= D307), D308 (= D309), D338 (= D339)
- binding cobalt (ii) ion: E231 (= E232), E267 (= E268), E267 (= E268), H270 (= H271), D295 (= D296), D306 (= D307), D308 (= D309), D338 (= D339)
1a0eA Xylose isomerase from thermotoga neapolitana
51% identity, 99% coverage: 4:437/440 of query aligns to 3:435/443 of 1a0eA
- active site: H100 (= H101), D103 (= D104), W138 (= W139), E231 (= E232), K233 (= K234), E267 (= E268), H270 (= H271), D295 (= D296), D306 (= D307), D308 (= D309), D338 (= D339)
- binding cobalt (ii) ion: E231 (= E232), E267 (= E268), E267 (= E268), H270 (= H271), D295 (= D296), D308 (= D309), D338 (= D339)
1a0dA Xylose isomerase from bacillus stearothermophilus
53% identity, 99% coverage: 4:439/440 of query aligns to 2:435/437 of 1a0dA
- active site: H98 (= H101), D101 (= D104), W136 (= W139), E229 (= E232), K231 (= K234), E265 (= E268), H268 (= H271), D293 (= D296), D304 (= D307), D306 (= D309), D336 (= D339)
- binding manganese (ii) ion: E229 (= E232), E265 (= E268), E265 (= E268), H268 (= H271), D293 (= D296), D304 (= D307), D306 (= D309), D336 (= D339)
5nhcA Crystal structure of xylose isomerase from piromyces e2 in complex with two co2+ ions and xylulose (see paper)
48% identity, 99% coverage: 2:436/440 of query aligns to 2:435/436 of 5nhcA
- active site: H101 (= H101), D104 (= D104), W139 (= W139), E232 (= E232), K234 (= K234), E268 (= E268), H271 (= H271), D296 (= D296), D307 (= D307), D309 (= D309), D339 (= D339)
- binding cobalt (ii) ion: E232 (= E232), E268 (= E268), E268 (= E268), H271 (= H271), D296 (= D296), D307 (= D307), D309 (= D309), D339 (= D339)
- binding 4-hydroxyproline: G290 (= G290), L292 (≠ F292), G328 (≠ A328), G330 (= G330), V332 (≠ T332)
- binding d-xylulose: W49 (= W49), H101 (= H101), W188 (= W188), E232 (= E232), E268 (= E268), H271 (= H271), D339 (= D339)
5nhaA Crystal structure of xylose isomerase from piromyces sp. E2 in complex with two mn2+ ions and sorbitol (see paper)
48% identity, 99% coverage: 2:436/440 of query aligns to 2:435/436 of 5nhaA
- active site: H101 (= H101), D104 (= D104), W139 (= W139), E232 (= E232), K234 (= K234), E268 (= E268), H271 (= H271), D296 (= D296), D307 (= D307), D309 (= D309), D339 (= D339)
- binding manganese (ii) ion: E232 (= E232), E268 (= E268), E268 (= E268), H271 (= H271), D296 (= D296), D307 (= D307), D309 (= D309), D339 (= D339)
- binding sorbitol: W49 (= W49), H101 (= H101), W188 (= W188), E232 (= E232), D339 (= D339)
5nh9A Crystal structure of xylose isomerase from piromyces e2 in complex with two mn2+ ions and xylose (see paper)
48% identity, 99% coverage: 2:436/440 of query aligns to 2:435/436 of 5nh9A
- active site: H101 (= H101), D104 (= D104), W139 (= W139), E232 (= E232), K234 (= K234), E268 (= E268), H271 (= H271), D296 (= D296), D307 (= D307), D309 (= D309), D339 (= D339)
- binding manganese (ii) ion: E232 (= E232), E268 (= E268), E268 (= E268), H271 (= H271), D296 (= D296), D307 (= D307), D309 (= D309), D339 (= D339)
- binding D-xylose: W49 (= W49), H101 (= H101), W188 (= W188), E232 (= E232), E268 (= E268), H271 (= H271), D339 (= D339)
- binding beta-D-xylopyranose: G63 (= G63), K65 (≠ F65), S66 (≠ N66), K203 (≠ R203), K206 (≠ R206), H257 (≠ F257), D288 (≠ A288), A289 (≠ L289)
5nh7A Crystal structure of xylose isomerase from piromyces e2 in complex with two mg2+ ions and xylose (see paper)
48% identity, 99% coverage: 2:436/440 of query aligns to 2:435/436 of 5nh7A
- active site: H101 (= H101), D104 (= D104), W139 (= W139), E232 (= E232), K234 (= K234), E268 (= E268), H271 (= H271), D296 (= D296), D307 (= D307), D309 (= D309), D339 (= D339)
- binding magnesium ion: E232 (= E232), E268 (= E268), E268 (= E268), H271 (= H271), D296 (= D296), D307 (= D307), D309 (= D309), D339 (= D339)
- binding D-xylose: W49 (= W49), H101 (= H101), W188 (= W188), E232 (= E232), E268 (= E268), H271 (= H271), D339 (= D339)
- binding beta-D-xylopyranose: G63 (= G63), K65 (≠ F65), S66 (≠ N66)
- binding alpha-D-xylopyranose: P21 (= P21), D40 (≠ E40), Y97 (≠ F97), K136 (= K136), E350 (≠ Y350)
5nh6A Crystal structure of xylose isomerase from piromyces e2 complexed with one mg2+ ion and xylitol (see paper)
48% identity, 99% coverage: 2:436/440 of query aligns to 2:435/436 of 5nh6A
- active site: H101 (= H101), D104 (= D104), W139 (= W139), E232 (= E232), K234 (= K234), E268 (= E268), H271 (= H271), D296 (= D296), D307 (= D307), D309 (= D309), D339 (= D339)
- binding magnesium ion: E232 (= E232), E268 (= E268), D296 (= D296), D339 (= D339)
- binding Xylitol: W49 (= W49), H101 (= H101), W188 (= W188), E232 (= E232), E268 (= E268), H271 (= H271), D339 (= D339)
5nh5A Crystal structure of native xylose isomerase from piromyces e2 (see paper)
48% identity, 99% coverage: 2:436/440 of query aligns to 2:435/436 of 5nh5A
- active site: H101 (= H101), D104 (= D104), W139 (= W139), E232 (= E232), K234 (= K234), E268 (= E268), H271 (= H271), D296 (= D296), D307 (= D307), D309 (= D309), D339 (= D339)
- binding calcium ion: E232 (= E232), E268 (= E268), D296 (= D296), D339 (= D339)
- binding fe (ii) ion: E232 (= E232), E268 (= E268), D296 (= D296), D339 (= D339)
- binding magnesium ion: E232 (= E232), E268 (= E268), D296 (= D296), D339 (= D339)
5nh4A Crystal structure of xylose isomerase from piromyces e2 in complex with one mg2+ ions and glycerol (see paper)
48% identity, 99% coverage: 2:436/440 of query aligns to 2:435/436 of 5nh4A
- active site: H101 (= H101), D104 (= D104), W139 (= W139), E232 (= E232), K234 (= K234), E268 (= E268), H271 (= H271), D296 (= D296), D307 (= D307), D309 (= D309), D339 (= D339)
- binding magnesium ion: E232 (= E232), E268 (= E268), D296 (= D296), D339 (= D339)
5yn3A Crystal structure of xylose isomerase from piromyces sp. E2 (see paper)
48% identity, 99% coverage: 2:436/440 of query aligns to 1:434/435 of 5yn3A
- active site: H100 (= H101), D103 (= D104), W138 (= W139), E231 (= E232), K233 (= K234), E267 (= E268), H270 (= H271), D295 (= D296), D306 (= D307), D308 (= D309), D338 (= D339)
- binding glycerol: H100 (= H101), W187 (= W188), E231 (= E232), D295 (= D296)
- binding manganese (ii) ion: E231 (= E232), E267 (= E268), E267 (= E268), H270 (= H271), D295 (= D296), D306 (= D307), D308 (= D309), D338 (= D339)
4xkmA Crystal structure of xylose isomerase from an human intestinal tract microbe bacteroides thetaiotaomicron
49% identity, 98% coverage: 4:436/440 of query aligns to 3:434/435 of 4xkmA
- active site: F23 (= F24), E29 (≠ D30), H100 (= H101), D103 (= D104), W138 (= W139), E231 (= E232), K233 (= K234), E267 (= E268), H270 (= H271), D295 (= D296), D306 (= D307), D308 (= D309), D338 (= D339)
- binding manganese (ii) ion: E231 (= E232), E267 (= E268), E267 (= E268), H270 (= H271), D295 (= D296), D306 (= D307), D308 (= D309), D338 (= D339)
6intA Xylose isomerase from paenibacillus sp. R4 (see paper)
47% identity, 99% coverage: 4:439/440 of query aligns to 1:412/413 of 6intA
- active site: H74 (= H101), D77 (= D104), W112 (= W139), E205 (= E232), K207 (= K234), E241 (= E268), H244 (= H271), D269 (= D296), D280 (= D307), D282 (= D309), D313 (= D339)
- binding calcium ion: G166 (= G193), E178 (= E205), E205 (= E232), E241 (= E268), E241 (= E268), H244 (= H271), D269 (= D296), D280 (= D307), D282 (= D309), D313 (= D339)
4qehA Room temperature x-ray structure of d-xylose isomerase in complex with two mg2+ ions and l-ribose (see paper)
28% identity, 70% coverage: 43:351/440 of query aligns to 10:297/388 of 4qehA
- active site: H54 (= H101), D57 (= D104), M88 (≠ W139), E181 (= E232), K183 (= K234), E217 (= E268), H220 (= H271), D245 (= D296), D255 (= D307), D257 (= D309), D287 (= D339)
- binding beta-L-ribofuranose: W16 (= W49), H54 (= H101), W137 (= W188), E181 (= E232), D287 (= D339)
- binding magnesium ion: E181 (= E232), E217 (= E268), E217 (= E268), H220 (= H271), D245 (= D296), D255 (= D307), D257 (= D309), D287 (= D339)
4qeeA Room temperature x-ray structure of d-xylose isomerase in complex with two ni2+ ions and l-ribose (see paper)
28% identity, 70% coverage: 43:351/440 of query aligns to 10:297/388 of 4qeeA
- active site: H54 (= H101), D57 (= D104), M88 (≠ W139), E181 (= E232), K183 (= K234), E217 (= E268), H220 (= H271), D245 (= D296), D255 (= D307), D257 (= D309), D287 (= D339)
- binding alpha-L-ribofuranose: W16 (= W49), H54 (= H101), F94 (= F145), E181 (= E232), D287 (= D339)
4qe4A Room temperature x-ray structure of d-xylose isomerase in complex with two ni2+ ions and l-ribulose (see paper)
28% identity, 70% coverage: 43:351/440 of query aligns to 10:297/388 of 4qe4A
- active site: H54 (= H101), D57 (= D104), M88 (≠ W139), E181 (= E232), K183 (= K234), E217 (= E268), H220 (= H271), D245 (= D296), D255 (= D307), D257 (= D309), D287 (= D339)
- binding beta-L-ribulofuranose: W16 (= W49), H54 (= H101), W137 (= W188), E181 (= E232), D287 (= D339)
4qe1A Room temperature x-ray structure of d-xylose isomerase in complex with two cd2+ ions and l-ribulose (see paper)
28% identity, 70% coverage: 43:351/440 of query aligns to 10:297/388 of 4qe1A
- active site: H54 (= H101), D57 (= D104), M88 (≠ W139), E181 (= E232), K183 (= K234), E217 (= E268), H220 (= H271), D245 (= D296), D255 (= D307), D257 (= D309), D287 (= D339)
- binding alpha-L-ribulofuranose: W16 (= W49), H54 (= H101), W137 (= W188), E181 (= E232), D287 (= D339)
4qdwA Joint x-ray and neutron structure of streptomyces rubiginosus d-xylose isomerase in complex with two ni2+ ions and linear l-arabinose (see paper)
28% identity, 70% coverage: 43:351/440 of query aligns to 10:297/388 of 4qdwA
- active site: H54 (= H101), D57 (= D104), M88 (≠ W139), E181 (= E232), K183 (= K234), E217 (= E268), H220 (= H271), D245 (= D296), D255 (= D307), D257 (= D309), D287 (= D339)
- binding L-arabinose: H54 (= H101), W137 (= W188), E181 (= E232), K183 (= K234), H220 (= H271), D287 (= D339)
4qdpA Joint x-ray and neutron structure of streptomyces rubiginosus d-xylose isomerase in complex with two cd2+ ions and cyclic beta-l-arabinose (see paper)
28% identity, 70% coverage: 43:351/440 of query aligns to 10:297/388 of 4qdpA
- active site: H54 (= H101), D57 (= D104), M88 (≠ W139), E181 (= E232), K183 (= K234), E217 (= E268), H220 (= H271), D245 (= D296), D255 (= D307), D257 (= D309), D287 (= D339)
- binding beta-L-arabinopyranose: H54 (= H101), F94 (= F145), W137 (= W188), E181 (= E232), D287 (= D339)
Query Sequence
>17626 FitnessBrowser__Keio:17626
MQAYFDQLDRVRYEGSKSSNPLAFRHYNPDELVLGKRMEEHLRFAACYWHTFCWNGADMF
GVGAFNRPWQQPGEALALAKRKADVAFEFFHKLHVPFYCFHDVDVSPEGASLKEYINNFA
QMVDVLAGKQEESGVKLLWGTANCFTNPRYGAGAATNPDPEVFSWAATQVVTAMEATHKL
GGENYVLWGGREGYETLLNTDLRQEREQLGRFMQMVVEHKHKIGFQGTLLIEPKPQEPTK
HQYDYDAATVYGFLKQFGLEKEIKLNIEANHATLAGHSFHHEIATAIALGLFGSVDANRG
DAQLGWDTDQFPNSVEENALVMYEILKAGGFTTGGLNFDAKVRRQSTDKYDLFYGHIGAM
DTMALALKIAARMIEDGELDKRIAQRYSGWNSELGQQILKGQMSLADLAKYAQEHHLSPV
HQSGRQEQLENLVNHYLFDK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory