Comparing 17627 FitnessBrowser__Keio:17627 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ma0A Closed liganded crystal structure of xylose binding protein from escherichia coli (see paper)
100% identity, 93% coverage: 24:330/330 of query aligns to 1:307/313 of 3ma0A
4ywhA Crystal structure of an abc transporter solute binding protein (ipr025997) from actinobacillus succinogenes 130z (asuc_0499, target efi-511068) with bound d-xylose
77% identity, 92% coverage: 24:325/330 of query aligns to 2:303/310 of 4ywhA
3uugA Crystal structure of the periplasmic sugar binding protein chve (see paper)
40% identity, 92% coverage: 28:330/330 of query aligns to 5:328/329 of 3uugA
3urmA Crystal structure of the periplasmic sugar binding protein chve (see paper)
40% identity, 92% coverage: 28:330/330 of query aligns to 5:328/329 of 3urmA
4wwhA Crystal structure of an abc transporter solute binding protein (ipr025997) from mycobacterium smegmatis (msmeg_1704, target efi- 510967) with bound d-galactose
39% identity, 92% coverage: 28:330/330 of query aligns to 5:328/329 of 4wwhA
4ys6A Crystal structure of an abc transporter solute binding protein (ipr025997) from clostridium phytofermentans (cphy_1585, target efi- 511156) with bound beta-d-glucose
36% identity, 92% coverage: 28:330/330 of query aligns to 3:323/324 of 4ys6A
4rxuA Crystal structure of carbohydrate transporter solute binding protein caur_1924 from chloroflexus aurantiacus, target efi-511158, in complex with d-glucose
30% identity, 93% coverage: 24:330/330 of query aligns to 2:336/340 of 4rxuA
6ruxA P46, an immunodominant surface protein from mycoplasma hyopneumoniae (see paper)
31% identity, 76% coverage: 28:277/330 of query aligns to 13:311/373 of 6ruxA
6s3tA P46, an immunodominant surface protein from mycoplasma hyopneumoniae (see paper)
31% identity, 76% coverage: 28:277/330 of query aligns to 15:313/374 of 6s3tA
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
32% identity, 70% coverage: 49:278/330 of query aligns to 24:248/274 of 2ioyA
Sites not aligning to the query:
4ry9B Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
27% identity, 88% coverage: 27:315/330 of query aligns to 4:287/297 of 4ry9B
4ry9A Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
27% identity, 88% coverage: 27:315/330 of query aligns to 4:287/297 of 4ry9A
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
31% identity, 68% coverage: 41:263/330 of query aligns to 30:244/287 of 5dteB
Sites not aligning to the query:
A0QYB5 D-threitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
28% identity, 76% coverage: 8:257/330 of query aligns to 20:261/349 of A0QYB5
Sites not aligning to the query:
A0QYB3 Xylitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
28% identity, 85% coverage: 12:290/330 of query aligns to 21:294/349 of A0QYB3
5hkoA Crystal structure of abc transporter solute binding protein msmeg_3598 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with l-sorbitol
30% identity, 69% coverage: 62:290/330 of query aligns to 37:261/314 of 5hkoA
Sites not aligning to the query:
4rs3A Crystal structure of carbohydrate transporter a0qyb3 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with xylitol (see paper)
30% identity, 69% coverage: 62:290/330 of query aligns to 37:261/315 of 4rs3A
Sites not aligning to the query:
4rsmA Crystal structure of carbohydrate transporter msmeg_3599 from mycobacterium smegmatis str. Mc2 155, target efi-510970, in complex with d-threitol (see paper)
32% identity, 59% coverage: 62:257/330 of query aligns to 38:229/315 of 4rsmA
Sites not aligning to the query:
4yo7A Crystal structure of an abc transporter solute binding protein (ipr025997) from bacillus halodurans c-125 (bh2323, target efi- 511484) with bound myo-inositol
27% identity, 78% coverage: 59:316/330 of query aligns to 39:286/287 of 4yo7A
Sites not aligning to the query:
4rxmA Crystal structure of periplasmic abc transporter solute binding protein a7jw62 from mannheimia haemolytica phl213, target efi-511105, in complex with myo-inositol
28% identity, 74% coverage: 46:288/330 of query aligns to 25:264/291 of 4rxmA
Sites not aligning to the query:
>17627 FitnessBrowser__Keio:17627
MKIKNILLTLCTSLLLTNVAAHAKEVKIGMAIDDLRLERWQKDRDIFVKKAESLGAKVFV
QSANGNEETQMSQIENMINRGVDVLVIIPYNGQVLSNVVKEAKQEGIKVLAYDRMINDAD
IDFYISFDNEKVGELQAKALVDIVPQGNYFLMGGSPVDNNAKLFRAGQMKVLKPYVDSGK
IKVVGDQWVDGWLPENALKIMENALTANNNKIDAVVASNDATAGGAIQALSAQGLSGKVA
ISGQDADLAGIKRIAAGTQTMTVYKPITLLANTAAEIAVELGNGQEPKADTTLNNGLKDV
PSRLLTPIDVNKNNIKDTVIKDGFHKESEL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory