SitesBLAST
Comparing 17677 FitnessBrowser__Keio:17677 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07913 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Escherichia coli (strain K12) (see paper)
100% identity, 100% coverage: 1:341/341 of query aligns to 1:341/341 of P07913
- C38 (= C38) mutation to D: Shows only 1% of wild-type catalytic activity. This mutant can be stimulated to the wild-type activity level after incubation with Zn(+).; mutation to S: Loss of catalytic activity. This mutant cannot be stimulated to the wild-type activity level after incubation with Zn(+).
5kiaA Crystal structure of l-threonine 3-dehydrogenase from burkholderia thailandensis
76% identity, 100% coverage: 1:340/341 of query aligns to 2:338/339 of 5kiaA
- active site: C37 (= C38), G38 (= G39), T39 (= T40), H42 (= H43), H61 (= H63), E62 (= E64), C91 (= C93), C94 (= C96), C97 (= C99), C105 (= C107), V109 (≠ I111), P147 (= P149), A151 (= A153), K333 (= K335)
- binding calcium ion: D146 (= D148), N150 (= N152), E288 (= E290)
- binding zinc ion: C91 (= C93), C94 (= C96), C97 (= C99), C105 (= C107)
2dfvA Hyperthermophilic threonine dehydrogenase from pyrococcus horikoshii (see paper)
44% identity, 99% coverage: 1:338/341 of query aligns to 3:343/346 of 2dfvA
- active site: C40 (= C38), G41 (= G39), T42 (= T40), H45 (= H43), H65 (= H63), E66 (= E64), C95 (= C93), C98 (= C96), C101 (= C99), C109 (= C107), K113 (≠ I111), P151 (= P149), A155 (= A153), K340 (= K335)
- binding nicotinamide-adenine-dinucleotide: G175 (= G173), P176 (= P174), L177 (≠ I175), E197 (≠ D195), P198 (≠ V196), R202 (= R200), F241 (≠ M239), S242 (= S240), A244 (= A242), L264 (= L262), G265 (= G263), L266 (≠ I264), I289 (= I286), T290 (≠ Y287)
- binding zinc ion: C95 (= C93), C101 (= C99), C109 (= C107)
O58389 L-threonine 3-dehydrogenase; L-ThrDH; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 2 papers)
44% identity, 99% coverage: 1:338/341 of query aligns to 5:345/348 of O58389
- C42 (= C38) binding
- T44 (= T40) mutation to A: Total loss of enzymatic activity.
- H67 (= H63) binding
- E68 (= E64) binding
- C97 (= C93) binding
- C100 (= C96) binding
- C103 (= C99) binding
- C111 (= C107) binding
- E152 (≠ D148) mutation E->A,Q: Almost complete loss of enzymatic activity.; mutation to C: 120-fold decrease in catalytic efficiency.; mutation to D: Shows 3-fold higher turnover rate and reduced affinities toward L-threonine and NAD(+), compared to wild-type.; mutation to K: Total loss of enzymatic activity.
- L179 (≠ I175) binding
- E199 (≠ D195) binding ; mutation to A: Large decrease in affinity for NAD(+).
- R204 (= R200) binding ; mutation to A: Large decrease in affinity for NAD(+).
- LGL 266:268 (≠ LGI 262:264) binding
- IT 291:292 (≠ IY 286:287) binding
- R294 (= R289) mutation to A: 4000-fold decrease in catalytic efficiency.
3gfbA L-threonine dehydrogenase (tktdh) from the hyperthermophilic archaeon thermococcus kodakaraensis (see paper)
43% identity, 99% coverage: 1:338/341 of query aligns to 3:343/347 of 3gfbA
- active site: C40 (= C38), G41 (= G39), T42 (= T40), H45 (= H43), H65 (= H63), E66 (= E64), C95 (= C93), C98 (= C96), C101 (= C99), C109 (= C107), K113 (≠ I111), P151 (= P149), A155 (= A153), K340 (= K335)
- binding nicotinamide-adenine-dinucleotide: G173 (= G171), G175 (= G173), P176 (= P174), L177 (≠ I175), S196 (≠ T194), E197 (≠ D195), P198 (≠ V196), R202 (= R200), F241 (≠ M239), S242 (= S240), A244 (= A242), L264 (= L262), G265 (= G263), L266 (≠ I264), I289 (= I286), T290 (≠ Y287)
Q5JI69 L-threonine 3-dehydrogenase; TDH; L-threonine dehydrogenase; EC 1.1.1.103 from Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Pyrococcus kodakaraensis (strain KOD1)) (see paper)
43% identity, 99% coverage: 1:338/341 of query aligns to 5:345/350 of Q5JI69
2ejvA Crystal structure of threonine 3-dehydrogenase complexed with NAD+
43% identity, 99% coverage: 1:338/341 of query aligns to 1:339/343 of 2ejvA
- active site: C38 (= C38), G39 (= G39), T40 (= T40), H43 (= H43), H63 (= H63), E64 (= E64), C93 (= C93), C96 (= C96), C99 (= C99), C107 (= C107), Q111 (≠ I111), P149 (= P149), A153 (= A153), K336 (= K335)
- binding nicotinamide-adenine-dinucleotide: G172 (= G171), G174 (= G173), P175 (= P174), I176 (= I175), S195 (≠ T194), D196 (= D195), P197 (≠ V196), R201 (= R200), F238 (≠ M239), S239 (= S240), N241 (≠ A242), A244 (= A245), L261 (= L262), G262 (= G263), I263 (= I264)
- binding zinc ion: C38 (= C38), H63 (= H63), E64 (= E64), C96 (= C96), C99 (= C99), C107 (= C107)
2dq4A Crystal structure of threonine 3-dehydrogenase
43% identity, 99% coverage: 1:338/341 of query aligns to 1:339/343 of 2dq4A
- active site: C38 (= C38), G39 (= G39), T40 (= T40), H43 (= H43), H63 (= H63), E64 (= E64), C93 (= C93), C96 (= C96), C99 (= C99), C107 (= C107), Q111 (≠ I111), P149 (= P149), A153 (= A153), K336 (= K335)
- binding zinc ion: C38 (= C38), H63 (= H63), E64 (= E64), C93 (= C93), C96 (= C96), C107 (= C107)
Q5SKS4 L-threonine 3-dehydrogenase; TDH; EC 1.1.1.103 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
43% identity, 99% coverage: 1:338/341 of query aligns to 1:339/343 of Q5SKS4
7y9pA Xylitol dehydrogenase s96c/s99c/y102c mutant(thermostabilized form) from pichia stipitis (see paper)
33% identity, 91% coverage: 21:332/341 of query aligns to 22:347/357 of 7y9pA
P27867 Sorbitol dehydrogenase; SDH; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.14; EC 1.1.1.9 from Rattus norvegicus (Rat) (see paper)
30% identity, 96% coverage: 13:341/341 of query aligns to 20:351/357 of P27867
4ejmA Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021 bound to NADP
30% identity, 94% coverage: 1:320/341 of query aligns to 4:322/342 of 4ejmA
- active site: C40 (= C38), G41 (= G39), T42 (= T40), H45 (= H43), H61 (= H63), E62 (= E64), C91 (= C93), C94 (= C96), C97 (= C99), C105 (= C107), R109 (≠ I111), P147 (= P149), C151 (≠ A153)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G170 (= G171), G172 (= G173), V173 (≠ P174), I174 (= I175), T194 (≠ D195), R195 (≠ V196), Q196 (≠ N197), K199 (≠ R200), C240 (≠ M239), E245 (≠ P244), T246 (≠ A245), L263 (= L262), V265 (≠ I264), I291 (≠ G288)
- binding zinc ion: C91 (= C93), C94 (= C96), C97 (= C99), C105 (= C107)
Sites not aligning to the query:
4ej6A Crystal structure of a putative zinc-binding dehydrogenase (target psi-012003) from sinorhizobium meliloti 1021
30% identity, 94% coverage: 1:320/341 of query aligns to 4:322/343 of 4ej6A
- active site: C40 (= C38), G41 (= G39), T42 (= T40), H45 (= H43), H61 (= H63), E62 (= E64), C91 (= C93), C94 (= C96), C97 (= C99), C105 (= C107), R109 (≠ I111), P147 (= P149), C151 (≠ A153)
- binding zinc ion: C91 (= C93), C94 (= C96), C97 (= C99), C105 (= C107)
Sites not aligning to the query:
5vm2A Crystal structure of eck1772, an oxidoreductase/dehydrogenase of unknown specificity involved in membrane biogenesis from escherichia coli
29% identity, 95% coverage: 2:326/341 of query aligns to 5:329/347 of 5vm2A
- active site: C39 (= C38), G40 (= G39), S41 (≠ T40), H44 (= H43), H65 (= H63), E66 (= E64), C95 (= C93), C98 (= C96), C101 (= C99), C109 (= C107), D113 (vs. gap), P153 (= P149), G157 (≠ A153)
- binding magnesium ion: H65 (= H63), E66 (= E64), E152 (≠ D148)
- binding zinc ion: C95 (= C93), C98 (= C96), C101 (= C99), C109 (= C107)
Sites not aligning to the query:
Q00796 Sorbitol dehydrogenase; SDH; (R,R)-butanediol dehydrogenase; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Ribitol dehydrogenase; RDH; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.4; EC 1.1.1.14; EC 1.1.1.56; EC 1.1.1.9 from Homo sapiens (Human) (see 10 papers)
28% identity, 96% coverage: 13:341/341 of query aligns to 20:351/357 of Q00796
- C45 (= C38) binding
- H70 (= H63) binding
- E71 (= E64) binding
- R110 (= R103) to P: in SORDD; results in protein aggregation
- H135 (≠ I127) to R: in SORDD; results in protein aggregation
- A153 (= A145) to D: in SORDD; uncertain significance; results in protein aggregation; dbSNP:rs145813597
- I184 (= I175) binding
- D204 (= D195) binding
- R209 (= R200) binding
- Q239 (≠ T230) to L: in dbSNP:rs1042079
- N269 (≠ R258) to T: in dbSNP:rs930337
- VGL 273:275 (≠ LGI 262:264) binding
- VF--R 297:299 (≠ IYGRE 286:290) binding
- V322 (≠ I312) to I: in SORDD; uncertain significance; dbSNP:rs149975952
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
1pl6A Human sdh/nadh/inhibitor complex (see paper)
28% identity, 96% coverage: 13:341/341 of query aligns to 19:350/356 of 1pl6A
- active site: C44 (= C38), G45 (= G39), S46 (≠ T40), H49 (= H43), H69 (= H63), E70 (= E64), R99 (≠ C93), D102 (≠ C96), C105 (= C99), S113 (≠ R108), F117 (≠ G112), P156 (= P149), G160 (≠ A153), K344 (= K335)
- binding 4-[2-(hydroxymethyl)pyrimidin-4-yl]-n,n-dimethylpiperazine-1-sulfonamide: C44 (= C38), S46 (≠ T40), I56 (≠ W50), F59 (≠ K53), H69 (= H63), E155 (≠ D148), L274 (≠ I264), F297 (≠ Y287)
- binding nicotinamide-adenine-dinucleotide: G181 (= G173), P182 (= P174), I183 (= I175), D203 (= D195), L204 (≠ V196), R208 (= R200), C249 (≠ M239), T250 (≠ S240), V272 (≠ L262), G273 (= G263), L274 (≠ I264), F297 (≠ Y287), R298 (≠ E290)
- binding zinc ion: C44 (= C38), H69 (= H63)
4ilkA Crystal structure of short chain alcohol dehydrogenase (rspb) from e. Coli cft073 (efi target efi-506413) complexed with cofactor nadh
30% identity, 91% coverage: 17:328/341 of query aligns to 21:320/337 of 4ilkA
- active site: C40 (= C38), G41 (= G39), S42 (≠ T40), H45 (= H43), H59 (= H63), E60 (= E64), C89 (= C93), C92 (= C96), C95 (= C99), C103 (= C107), A107 (≠ I111), P145 (= P149), A149 (= A153)
- binding manganese (ii) ion: C40 (= C38), H59 (= H63), E60 (= E64), E144 (≠ D148)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G168 (= G171), G170 (= G173), P171 (= P174), I172 (= I175), D193 (= D195), R194 (≠ V196), R198 (= R200), N213 (≠ V215), A235 (≠ M239), A236 (≠ S240), C237 (≠ G241), I241 (≠ A245), M258 (≠ L262), F260 (≠ M269)
- binding zinc ion: C89 (= C93), C92 (= C96), C95 (= C99), C103 (= C107)
Sites not aligning to the query:
Q7SI09 L-arabinitol 4-dehydrogenase; LAD; EC 1.1.1.12 from Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) (see 2 papers)
29% identity, 92% coverage: 22:336/341 of query aligns to 37:355/363 of Q7SI09
- C53 (= C38) binding
- F59 (≠ I44) mutation F->A,S,Y: No effect.
- H78 (= H63) binding
- E79 (= E64) binding
- C108 (= C93) binding
- C111 (= C96) binding
- C114 (= C99) binding
- C122 (= C107) binding
- E163 (≠ D148) binding
- PI 190:191 (= PI 174:175) binding
- D211 (= D195) binding
- DI 211:212 (≠ DV 195:196) mutation to SR: Alters cofactor specificity from NAD to NADP; when associated with T-348.
- R216 (= R200) binding
- I282 (≠ L262) binding
- QY--R 306:308 (≠ IYGRE 286:290) binding
- S348 (≠ R329) mutation to T: Alters cofactor specificity from NAD to NADP; when associated with 211-SR-212.
3m6iA L-arabinitol 4-dehydrogenase (see paper)
29% identity, 92% coverage: 22:336/341 of query aligns to 33:351/358 of 3m6iA
- active site: C49 (= C38), G50 (= G39), S51 (≠ T40), H54 (= H43), H74 (= H63), E75 (= E64), C104 (= C93), C107 (= C96), C110 (= C99), C118 (= C107), D122 (≠ I111), P160 (= P149), A164 (= A153)
- binding nicotinamide-adenine-dinucleotide: C49 (= C38), V163 (≠ N152), G185 (= G173), P186 (= P174), I187 (= I175), D207 (= D195), R212 (= R200), C255 (≠ M239), T256 (≠ S240), I278 (≠ L262), G279 (= G263), V280 (≠ I264), R304 (≠ E290)
- binding zinc ion: C49 (= C38), H74 (= H63), C104 (= C93), C107 (= C96), C110 (= C99), C118 (= C107)
Sites not aligning to the query:
3qe3A Sheep liver sorbitol dehydrogenase (see paper)
28% identity, 96% coverage: 13:341/341 of query aligns to 14:345/351 of 3qe3A
- active site: C39 (= C38), G40 (= G39), S41 (≠ T40), H44 (= H43), H64 (= H63), E65 (= E64), R94 (= R97), D97 (vs. gap), C100 (= C99), S108 (≠ R108), F112 (≠ G112), P151 (= P149), G155 (≠ A153), K339 (= K335)
- binding glycerol: Y45 (≠ I44), F54 (≠ K53), T116 (≠ N116), R293 (≠ E290)
- binding zinc ion: C39 (= C38), H64 (= H63), E65 (= E64)
Query Sequence
>17677 FitnessBrowser__Keio:17677
MKALSKLKAEEGIWMTDVPVPELGHNDLLIKIRKTAICGTDVHIYNWDEWSQKTIPVPMV
VGHEYVGEVVGIGQEVKGFKIGDRVSGEGHITCGHCRNCRGGRTHLCRNTIGVGVNRPGC
FAEYLVIPAFNAFKIPDNISDDLAAIFDPFGNAVHTALSFDLVGEDVLVSGAGPIGIMAA
AVAKHVGARNVVITDVNEYRLELARKMGITRAVNVAKENLNDVMAELGMTEGFDVGLEMS
GAPPAFRTMLDTMNHGGRIAMLGIPPSDMSIDWTKVIFKGLFIKGIYGREMFETWYKMAA
LIQSGLDLSPIITHRFSIDDFQKGFDAMRSGQSGKVILSWD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory