Comparing 17840 FitnessBrowser__Keio:17840 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P61887 Glucose-1-phosphate thymidylyltransferase 2; G1P-TT 2; dTDP-glucose pyrophosphorylase 2; dTDP-glucose synthase 2; EC 2.7.7.24 from Escherichia coli (strain K12) (see paper)
100% identity, 100% coverage: 1:293/293 of query aligns to 1:293/293 of P61887
1mc3A Crystal structure of rffh (see paper)
100% identity, 99% coverage: 1:290/293 of query aligns to 2:291/291 of 1mc3A
5ifyA Crystal structure of glucose-1-phosphate thymidylyltransferase from burkholderia vietnamiensis in complex with 2 -deoxyuridine-5'- monophosphate and 2'-deoxy-thymidine-b-l-rhamnose
65% identity, 97% coverage: 2:286/293 of query aligns to 3:287/293 of 5ifyA
4b2xB Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
66% identity, 97% coverage: 2:286/293 of query aligns to 13:297/302 of 4b2xB
3zllA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
66% identity, 97% coverage: 2:286/293 of query aligns to 8:292/297 of 3zllA
3zlkA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
66% identity, 97% coverage: 2:286/293 of query aligns to 8:292/297 of 3zlkA
4ho9A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with udp-galactose and utp
66% identity, 97% coverage: 1:285/293 of query aligns to 1:285/294 of 4ho9A
5fuhA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
66% identity, 97% coverage: 2:286/293 of query aligns to 9:293/298 of 5fuhA
4b4mA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
66% identity, 97% coverage: 2:286/293 of query aligns to 7:291/296 of 4b4mA
4b4bA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
66% identity, 97% coverage: 2:286/293 of query aligns to 9:293/298 of 4b4bA
4ho4A Crystal structure of glucose 1-phosphate thymidylyltransferase from aneurinibacillus thermoaerophilus complexed with thymidine and glucose-1-phosphate
66% identity, 97% coverage: 1:285/293 of query aligns to 1:285/289 of 4ho4A
5fyeA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
66% identity, 97% coverage: 2:286/293 of query aligns to 7:291/296 of 5fyeA
5fu0A Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
66% identity, 97% coverage: 2:286/293 of query aligns to 7:291/296 of 5fu0A
5ftvA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
66% identity, 97% coverage: 2:286/293 of query aligns to 7:291/296 of 5ftvA
5ftsA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
66% identity, 97% coverage: 2:286/293 of query aligns to 7:291/296 of 5ftsA
5fu8A Pseudomonas aeruginosa rmla in complex with allosteric inhibitor
66% identity, 97% coverage: 2:286/293 of query aligns to 8:292/297 of 5fu8A
4b2wA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
66% identity, 97% coverage: 2:286/293 of query aligns to 8:292/297 of 4b2wA
4asjA Pseudomonas aeruginosa rmla in complex with allosteric inhibitor (see paper)
66% identity, 97% coverage: 2:286/293 of query aligns to 3:287/292 of 4asjA
1g3lA The structural basis of the catalytic mechanism and regulation of glucose-1-phosphate thymidylyltransferase (rmla). Tdp-l-rhamnose complex. (see paper)
66% identity, 97% coverage: 2:286/293 of query aligns to 3:287/292 of 1g3lA
1g2vA The structural basis of the catalytic mechanism and regulation of glucose-1-phosphate thymidylyltransferase (rmla). Ttp complex. (see paper)
66% identity, 97% coverage: 2:286/293 of query aligns to 3:287/292 of 1g2vA
>17840 FitnessBrowser__Keio:17840
MKGIILAGGSGTRLHPITRGVSKQLLPIYDKPMIYYPLSVLMLAGIREILIITTPEDKGY
FQRLLGDGSEFGIQLEYAEQPSPDGLAQAFIIGETFLNGEPSCLVLGDNIFFGQGFSPKL
RHVAARTEGATVFGYQVMDPERFGVVEFDDNFRAISLEEKPKQPKSNWAVTGLYFYDSKV
VEYAKQVKPSERGELEITSINQMYLEAGNLTVELLGRGFAWLDTGTHDSLIEASTFVQTV
EKRQGFKIACLEEIAWRNGWLDDEGVKRAASSLAKTGYGQYLLELLRARPRQY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory