SitesBLAST
Comparing 17858 FitnessBrowser__Keio:17858 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
P0A6K1 Diaminopimelate epimerase; DAP epimerase; PLP-independent amino acid racemase; EC 5.1.1.7 from Escherichia coli (strain K12) (see paper)
100% identity, 100% coverage: 1:274/274 of query aligns to 1:274/274 of P0A6K1
- Y268 (= Y268) Important for dimerization; mutation to A: Significantly less active than the wild-type dimer and unable to dimerize.
2gkjA Crystal structure of diaminopimelate epimerase in complex with an irreversible inhibitor dl-azidap (see paper)
77% identity, 100% coverage: 1:274/274 of query aligns to 1:274/274 of 2gkjA
- active site: C73 (= C73), H159 (= H159), E208 (= E208), C217 (= C217), G220 (= G220)
- binding (2r,6s)-2,6-diamino-2-methylheptanedioic acid: N11 (= N11), Q44 (= Q44), N64 (= N64), C73 (= C73), G74 (= G74), N75 (= N75), N157 (= N157), N190 (= N190), E208 (= E208), R209 (= R209), C217 (= C217), G218 (= G218), S219 (= S219)
2gkeA Crystal structure of diaminopimelate epimerase in complex with an irreversible inhibitor ll-azidap (see paper)
77% identity, 100% coverage: 1:274/274 of query aligns to 1:274/274 of 2gkeA
- active site: C73 (= C73), H159 (= H159), E208 (= E208), C217 (= C217), G220 (= G220)
- binding (2s,6s)-2,6-diamino-2-methylheptanedioic acid: N11 (= N11), F13 (= F13), Q44 (= Q44), N64 (= N64), V70 (= V70), C73 (= C73), G74 (= G74), N75 (= N75), N157 (= N157), N190 (= N190), E208 (= E208), R209 (= R209), C217 (= C217), G218 (= G218), S219 (= S219)
P44859 Diaminopimelate epimerase; DAP epimerase; PLP-independent amino acid racemase; EC 5.1.1.7 from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
77% identity, 100% coverage: 1:274/274 of query aligns to 1:274/274 of P44859
- N11 (= N11) binding
- Q44 (= Q44) binding
- N64 (= N64) binding
- C73 (= C73) mutation to A: Inactive as epimerase, but it is able to rapidly catalyze the HF elimination via abstraction of the C-2 hydrogen of the D,L-3-fluoro-DAP analog and is essentially unable to catalyze the same elimination with the L,L-3-fluoro-DAP analog.; mutation to S: Enzymatically active, but it adopts a more open conformation. It is able to catalyze both epimerization of DAP and HF elimination of L,L-3-fluoro-DAP and D,L-3-fluoro-DAP. Able to slowly eliminate HF but does not catalyze epimerization; when associated with S-217.
- GN 74:75 (= GN 74:75) binding
- N157 (= N157) binding
- N190 (= N190) binding
- ER 208:209 (= ER 208:209) binding
- C217 (= C217) mutation to A: Inactive as epimerase. It is able to rapidly catalyze the HF elimination via abstraction of the C-2 hydrogen of the L,L-3-fluoro-DAP analog and is essentially unable to catalyze the same elimination with the D,L-3-fluoro-DAP analog.; mutation to S: Enzymatically active, but it adopts a more open conformation. It is able to catalyze both epimerization of DAP and HF elimination of L,L-3-fluoro-DAP and D,L-3-fluoro-DAP. Able to slowly eliminate HF but does not catalyze epimerization; when associated with S-73.
- GS 218:219 (= GS 218:219) binding
3ejxD Crystal structure of diaminopimelate epimerase from arabidopsis thaliana in complex with ll-azidap (see paper)
40% identity, 99% coverage: 1:270/274 of query aligns to 17:297/301 of 3ejxD
- active site: C89 (= C73), H180 (= H159), E235 (= E208), C244 (= C217), G247 (= G220)
- binding (2s,6s)-2,6-diamino-2-methylheptanedioic acid: N27 (= N11), F29 (= F13), N80 (= N64), P86 (≠ V70), C89 (= C73), G90 (= G74), N91 (= N75), N178 (= N157), N217 (= N190), E235 (= E208), R236 (= R209), C244 (= C217), G245 (= G218), T246 (≠ S219)
3ekmA Crystal structure of diaminopimelate epimerase form arabidopsis thaliana in complex with irreversible inhibitor dl-azidap (see paper)
40% identity, 99% coverage: 1:270/274 of query aligns to 3:283/287 of 3ekmA
- active site: C75 (= C73), H166 (= H159), E221 (= E208), C230 (= C217), G233 (= G220)
- binding (2r,6s)-2,6-diamino-2-methylheptanedioic acid: N13 (= N11), N66 (= N64), P72 (≠ V70), C75 (= C73), G76 (= G74), N77 (= N75), N164 (= N157), N203 (= N190), E221 (= E208), R222 (= R209), C230 (= C217), G231 (= G218), T232 (≠ S219)
Q8NP73 Diaminopimelate epimerase; DAP epimerase; PLP-independent amino acid racemase; EC 5.1.1.7 from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025)
30% identity, 99% coverage: 3:274/274 of query aligns to 7:277/277 of Q8NP73
5m47A Crystal structure of dapf from corynebacterium glutamicum in complex with d,l-diaminopimelate (see paper)
30% identity, 99% coverage: 3:274/274 of query aligns to 7:277/280 of 5m47A
- active site: C83 (= C73), H161 (= H159), E212 (= E208), C221 (= C217), G224 (= G220)
- binding 2,6-diaminopimelic acid: N15 (= N11), N74 (= N64), C83 (= C73), G84 (= G74), N85 (= N75), N159 (= N157), N194 (= N190), E212 (= E208), R213 (= R209), C221 (= C217), G222 (= G218), T223 (≠ S219)
P9WP19 Diaminopimelate epimerase; DAP epimerase; PLP-independent amino acid racemase; EC 5.1.1.7 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
30% identity, 80% coverage: 1:220/274 of query aligns to 1:229/289 of P9WP19
- C87 (= C73) active site, Proton donor; mutation to A: Completely abolishes the diaminopimelate epimerase activity.; mutation to S: Strongly reduces the diaminopimelate epimerase activity.
- C226 (= C217) active site, Proton acceptor; mutation to A: Completely abolishes the diaminopimelate epimerase activity.; mutation to S: Strongly reduces the diaminopimelate epimerase activity.
Query Sequence
>17858 FitnessBrowser__Keio:17858
MQFSKMHGLGNDFMVVDAVTQNVFFSPELIRRLADRHLGVGFDQLLVVEPPYDPELDFHY
RIFNADGSEVAQCGNGARCFARFVRLKGLTNKRDIRVSTANGRMVLTVTDDDLVRVNMGE
PNFEPSAVPFRANKAEKTYIMRAAEQTILCGVVSMGNPHCVIQVDDVDTAAVETLGPVLE
SHERFPERANIGFMQVVKREHIRLRVYERGAGETQACGSGACAAVAVGIQQGLLAEEVRV
ELPGGRLDIAWKGPGHPLYMTGPAVHVYDGFIHL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory