Comparing 17942 FitnessBrowser__Keio:17942 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
1gt7A L-rhamnulose-1-phosphate aldolase from escherichia coli (see paper)
100% identity, 100% coverage: 1:274/274 of query aligns to 1:274/274 of 1gt7A
P32169 Rhamnulose-1-phosphate aldolase; EC 4.1.2.19 from Escherichia coli (strain K12) (see 2 papers)
100% identity, 100% coverage: 1:274/274 of query aligns to 1:274/274 of P32169
1ojrA L-rhamnulose-1-phosphate aldolase from escherichia coli (mutant e192a) (see paper)
100% identity, 100% coverage: 1:274/274 of query aligns to 1:274/274 of 1ojrA
2v9mA L-rhamnulose-1-phosphate aldolase from escherichia coli (mutant a87m- t109f-e192a) (see paper)
99% identity, 100% coverage: 1:274/274 of query aligns to 1:274/274 of 2v9mA
>17942 FitnessBrowser__Keio:17942
MQNITQSWFVQGMIKATTDAWLKGWDERNGGNLTLRLDDADIAPYHDNFHQQPRYIPLSQ
PMPLLANTPFIVTGSGKFFRNVQLDPAANLGIVKVDSDGAGYHILWGLTNEAVPTSELPA
HFLSHCERIKATNGKDRVIMHCHATNLIALTYVLENDTAVFTRQLWEGSTECLVVFPDGV
GILPWMVPGTDEIGQATAQEMQKHSLVLWPFHGVFGSGPTLDETFGLIDTAEKSAQVLVK
VYSMGGMKQTISREELIALGKRFGVTPLASALAL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory