Comparing 17944 FitnessBrowser__Keio:17944 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
P32171 L-Rhamnulokinase; RhaB; RhuK; ATP:L-rhamnulose phosphotransferase; L-rhamnulose 1-kinase; Rhamnulose kinase; EC 2.7.1.5 from Escherichia coli (strain K12) (see paper)
100% identity, 100% coverage: 1:489/489 of query aligns to 1:489/489 of P32171
Q1R415 Rhamnulokinase; Rhamnulose kinase; EC 2.7.1.5 from Escherichia coli (strain UTI89 / UPEC) (see paper)
99% identity, 100% coverage: 1:489/489 of query aligns to 1:489/489 of Q1R415
2uytA Structure of l-rhamnulose kinase in complex with adp and beta-l- rhamnulose. (see paper)
98% identity, 98% coverage: 2:480/489 of query aligns to 1:479/479 of 2uytA
2cglA Crystal structure of l-rhamnulose kinase from escherichia coli in complex with l-fructose, adp and a modeled atp gamma phosphate. (see paper)
98% identity, 98% coverage: 2:480/489 of query aligns to 1:479/479 of 2cglA
2cgjA Crystal structure of l-rhamnulose kinase from escherichia coli in complex with l-fructose and adp. (see paper)
98% identity, 98% coverage: 2:480/489 of query aligns to 1:479/479 of 2cgjA
6k76A Glycerol kinase form thermococcus kodakarensis, complex structure with substrate.
21% identity, 95% coverage: 6:470/489 of query aligns to 1:461/485 of 6k76A
3ll3B The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
24% identity, 24% coverage: 100:217/489 of query aligns to 95:212/490 of 3ll3B
Sites not aligning to the query:
3ll3A The crystal structure of ligand bound xylulose kinase from lactobacillus acidophilus
24% identity, 24% coverage: 100:217/489 of query aligns to 96:213/492 of 3ll3A
Sites not aligning to the query:
Q5HGD2 Glycerol kinase; ATP:glycerol 3-phosphotransferase; Glycerokinase; GK; EC 2.7.1.30 from Staphylococcus aureus (strain COL)
19% identity, 87% coverage: 4:430/489 of query aligns to 3:438/498 of Q5HGD2
3ge1A 2.7 angstrom crystal structure of glycerol kinase (glpk) from staphylococcus aureus in complex with adp and glycerol
19% identity, 87% coverage: 4:430/489 of query aligns to 4:439/499 of 3ge1A
3kzbA Crystal structure of xylulokinase from chromobacterium violaceum
25% identity, 37% coverage: 39:218/489 of query aligns to 24:218/498 of 3kzbA
Sites not aligning to the query:
>17944 FitnessBrowser__Keio:17944
MTFRNCVAVDLGASSGRVMLARYERECRSLTLREIHRFNNGLHSQNGYVTWDVDSLESAI
RLGLNKVCEEGIRIDSIGIDTWGVDFVLLDQQGQRVGLPVAYRDSRTNGLMAQAQQQLGK
RDIYQRSGIQFLPFNTLYQLRALTEQQPELIPHIAHALLMPDYFSYRLTGKMNWEYTNAT
TTQLVNINSDDWDESLLAWSGANKAWFGRPTHPGNVIGHWICPQGNEIPVVAVASHDTAS
AVIASPLNGSRAAYLSSGTWSLMGFESQTPFTNDTALAANITNEGGAEGRYRVLKNIMGL
WLLQRVLQEQQINDLPALISATQALPACRFIINPNDDRFINPETMCSEIQAACRETAQPI
PESDAELARCIFDSLALLYADVLHELAQLRGEDFSQLHIVGGGCQNTLLNQLCADACGIR
VIAGPVEASTLGNIGIQLMTLDELNNVDDFRQVVSTTANLTTFTPNPDSEIAHYVAQIHS
TRQTKELCA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory