SitesBLAST
Comparing 17955 b3916 6-phosphofructokinase (NCBI) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1pfkA Crystal structure of the complex of phosphofructokinase from escherichia coli with its reaction products (see paper)
100% identity, 100% coverage: 1:320/320 of query aligns to 1:320/320 of 1pfkA
- active site: G12 (= G12), R73 (= R73), F74 (= F74), D104 (= D104), G105 (= G105), G125 (= G125), T126 (= T126), D128 (= D128), D130 (= D130), R172 (= R172)
- binding adenosine-5'-diphosphate: G11 (= G11), R22 (= R22), R26 (= R26), Y56 (= Y56), S59 (= S59), D60 (= D60), R73 (= R73), F74 (= F74), F77 (= F77), R78 (= R78), G103 (= G103), D104 (= D104), G105 (= G105), S106 (= S106), M108 (= M108), G109 (= G109), R155 (= R155), G213 (= G213), K214 (= K214), H216 (= H216)
- binding 1,6-di-O-phosphono-beta-D-fructofuranose: G12 (= G12), R73 (= R73), T126 (= T126), D128 (= D128), M170 (= M170), E223 (= E223), H250 (= H250), R253 (= R253)
- binding magnesium ion: G186 (= G186), E188 (= E188)
P0A796 ATP-dependent 6-phosphofructokinase isozyme 1; ATP-PFK 1; Phosphofructokinase 1; 6-phosphofructokinase isozyme I; Phosphohexokinase 1; Sedoheptulose-7-phosphate kinase; EC 2.7.1.11 from Escherichia coli (strain K12) (see 2 papers)
100% identity, 100% coverage: 1:320/320 of query aligns to 1:320/320 of P0A796
- G12 (= G12) binding
- RGVVR 22:26 (= RGVVR 22:26) binding
- RYSVSD 55:60 (= RYSVSD 55:60) binding
- RF 73:74 (= RF 73:74) binding
- GDGS 103:106 (= GDGS 103:106) binding
- D104 (= D104) binding
- TID 126:128 (= TID 126:128) binding in other chain
- D128 (= D128) active site, Proton acceptor; mutation to S: 18000-fold reduction of catalytic rate.
- R155 (= R155) binding in other chain
- R163 (= R163) binding
- R172 (= R172) mutation to S: 3.4-fold reduction in turnover numbers.
- GCE 186:188 (= GCE 186:188) binding in other chain
- KKH 214:216 (= KKH 214:216) binding in other chain
- E223 (= E223) binding in other chain
- R244 (= R244) binding
- HIQR 250:253 (= HIQR 250:253) binding in other chain
6pfkA Phosphofructokinase, inhibited t-state (see paper)
57% identity, 94% coverage: 2:303/320 of query aligns to 1:302/319 of 6pfkA
- active site: G11 (= G12), R72 (= R73), C73 (≠ F74), D103 (= D104), G104 (= G105), G124 (= G125), T125 (= T126), D127 (= D128), D129 (= D130), R171 (= R172)
- binding 2-phosphoglycolic acid: R21 (= R22), R25 (= R26), G58 (≠ S59), D59 (= D60), R154 (= R155), R211 (≠ K212), K213 (= K214)
P00512 ATP-dependent 6-phosphofructokinase; ATP-PFK; Phosphofructokinase; Phosphohexokinase; EC 2.7.1.11 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see 2 papers)
57% identity, 94% coverage: 2:303/320 of query aligns to 1:302/319 of P00512
- RSVVR 21:25 (≠ RGVVR 22:26) binding
- D59 (= D60) binding
- RC 72:73 (≠ RF 73:74) binding
- D103 (= D104) binding
- TID 125:127 (= TID 126:128) binding in other chain
- R154 (= R155) binding in other chain
- R162 (= R163) binding
- MGR 169:171 (= MGR 170:172) binding in other chain
- GAE 185:187 (≠ GCE 186:188) binding in other chain
- R211 (≠ K212) binding in other chain
- KKH 213:215 (= KKH 214:216) binding in other chain
- E222 (= E223) binding in other chain
- R243 (= R244) binding
- HVQR 249:252 (≠ HIQR 250:253) binding in other chain
1mtoA Crystal structure of a phosphofructokinase mutant from bacillus stearothermophilus bound with fructose-6-phosphate (see paper)
57% identity, 94% coverage: 2:303/320 of query aligns to 1:302/319 of 1mtoA
- active site: G11 (= G12), R72 (= R73), C73 (≠ F74), D103 (= D104), G104 (= G105), G124 (= G125), T125 (= T126), D127 (= D128), D129 (= D130), R171 (= R172)
- binding 6-O-phosphono-beta-D-fructofuranose: D127 (= D128), R162 (= R163), M169 (= M170), R171 (= R172), E222 (= E223), R243 (= R244), H249 (= H250), R252 (= R253)
4pfkA Phosphofructokinase. Structure and control (see paper)
57% identity, 94% coverage: 2:303/320 of query aligns to 1:302/319 of 4pfkA
- active site: G11 (= G12), R72 (= R73), C73 (≠ F74), D103 (= D104), G104 (= G105), G124 (= G125), T125 (= T126), D127 (= D128), D129 (= D130), R171 (= R172)
- binding adenosine-5'-diphosphate: S9 (= S10), Y41 (= Y42), R72 (= R73), C73 (≠ F74), F76 (= F77), K77 (≠ R78), G104 (= G105), G108 (= G109), R154 (= R155), G185 (= G186), R211 (≠ K212), G212 (= G213), K213 (= K214), H215 (= H216)
- binding 6-O-phosphono-beta-D-fructofuranose: D127 (= D128), M169 (= M170), E222 (= E223), H249 (= H250), R252 (= R253)
- binding magnesium ion: G185 (= G186), E187 (= E188)
3pfkA Phosphofructokinase. Structure and control (see paper)
57% identity, 94% coverage: 2:303/320 of query aligns to 1:302/319 of 3pfkA
- active site: G11 (= G12), R72 (= R73), C73 (≠ F74), D103 (= D104), G104 (= G105), G124 (= G125), T125 (= T126), D127 (= D128), D129 (= D130), R171 (= R172)
- binding phosphate ion: R154 (= R155), K213 (= K214), H249 (= H250), R252 (= R253)
4i4iA Crystal structure of bacillus stearothermophilus phosphofructokinase mutant t156a bound to pep (see paper)
57% identity, 94% coverage: 2:303/320 of query aligns to 1:302/319 of 4i4iA
- active site: G11 (= G12), R72 (= R73), C73 (≠ F74), D103 (= D104), G104 (= G105), G124 (= G125), T125 (= T126), D127 (= D128), D129 (= D130), R171 (= R172)
- binding phosphoenolpyruvate: R21 (= R22), R25 (= R26), G58 (≠ S59), R154 (= R155), R211 (≠ K212), K213 (= K214), H215 (= H216)
5xz9A Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adenylylimidodiphosphate, the atp analogue (see paper)
50% identity, 99% coverage: 2:319/320 of query aligns to 1:320/321 of 5xz9A
- binding adenosine-5'-triphosphate: S9 (= S10), Y41 (= Y42), C73 (≠ F74), F76 (= F77), K77 (≠ R78), G102 (= G103), D103 (= D104), G104 (= G105), S105 (= S106), R107 (≠ M108), G108 (= G109)
5xzaA Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adp (see paper)
50% identity, 99% coverage: 2:319/320 of query aligns to 1:320/322 of 5xzaA
Q2FXM8 ATP-dependent 6-phosphofructokinase; ATP-PFK; Phosphofructokinase; Phosphohexokinase; EC 2.7.1.11 from Staphylococcus aureus (strain NCTC 8325 / PS 47) (see paper)
50% identity, 99% coverage: 2:319/320 of query aligns to 1:320/322 of Q2FXM8
- RC 72:73 (≠ RF 73:74) binding
- GDGS 102:105 (= GDGS 103:106) binding
- TID 127:129 (= TID 126:128) binding in other chain
- G150 (≠ E149) mutation to D: Exhibits higher affinity for fructose 6-phosphate and higher catalytic activity with a loss of dimer conversion; in association with A-151.
- L151 (≠ A150) mutation to A: Exhibits higher affinity for fructose 6-phosphate and higher catalytic activity with a loss of tetramer-dimer conversion; in association with D-150.
- R164 (= R163) mutation to A: Complete loss of fructose 6-phosphate binding.
- MGR 171:173 (= MGR 170:172) binding in other chain
- E224 (= E223) binding in other chain
- R245 (= R244) mutation to A: Complete loss of fructose 6-phosphate binding.
- HVQR 251:254 (≠ HIQR 250:253) binding in other chain
5xz6A Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adenylylimidodiphosphate, the atp analogue (see paper)
53% identity, 91% coverage: 2:293/320 of query aligns to 1:294/318 of 5xz6A
5xz7A Crystal structure of phosphofructokinase from staphylococcus aureus in complex with adenylylimidodiphosphate, the atp analogue (see paper)
53% identity, 91% coverage: 2:293/320 of query aligns to 1:294/322 of 5xz7A
4xyjF Crystal structure of human phosphofructokinase-1 in complex with atp and mg, northeast structural genomics consortium target hr9275 (see paper)
41% identity, 86% coverage: 3:277/320 of query aligns to 11:320/761 of 4xyjF
- active site: G20 (= G12), R83 (= R73), C84 (≠ F74), D114 (= D104), G158 (= G125), S159 (≠ T126), D161 (= D128), D163 (= D130), R205 (= R172)
- binding adenosine-5'-triphosphate: G20 (= G12), Y50 (= Y42), R83 (= R73), C84 (≠ F74), F87 (= F77), R88 (= R78), G113 (= G103), D114 (= D104), G115 (= G105), S116 (= S106), G119 (= G109), S159 (≠ T126)
- binding magnesium ion: G19 (= G11), G20 (= G12), G112 (= G102), D114 (= D104), G158 (= G125), D163 (= D130), R205 (= R172)
- binding phosphate ion: R30 (= R22), R34 (= R26), S69 (= S59), S70 (≠ D60), G219 (= G186), K250 (= K214)
Sites not aligning to the query:
4xykA Crystal structure of human phosphofructokinase-1 in complex with adp, northeast structural genomics consortium target hr9275 (see paper)
41% identity, 86% coverage: 3:277/320 of query aligns to 9:318/737 of 4xykA
- active site: G18 (= G12), R81 (= R73), C82 (≠ F74), D112 (= D104), G156 (= G125), S157 (≠ T126), D159 (= D128), D161 (= D130), R203 (= R172)
- binding adenosine-5'-diphosphate: Y48 (= Y42), R81 (= R73), C82 (≠ F74), R86 (= R78), G111 (= G103), D112 (= D104), G113 (= G105), S114 (= S106)
- binding phosphate ion: R28 (= R22), R32 (= R26), S67 (= S59), K248 (= K214)
Sites not aligning to the query:
4xyjA Crystal structure of human phosphofructokinase-1 in complex with atp and mg, northeast structural genomics consortium target hr9275 (see paper)
41% identity, 86% coverage: 3:277/320 of query aligns to 13:322/768 of 4xyjA
- active site: G22 (= G12), R85 (= R73), C86 (≠ F74), D116 (= D104), G160 (= G125), S161 (≠ T126), D163 (= D128), D165 (= D130), R207 (= R172)
- binding adenosine-5'-triphosphate: G21 (= G11), G22 (= G12), Y52 (= Y42), C86 (≠ F74), F89 (= F77), R90 (= R78), G115 (= G103), D116 (= D104), G117 (= G105), S118 (= S106), G121 (= G109), S161 (≠ T126), R207 (= R172)
- binding magnesium ion: G21 (= G11), G22 (= G12), D116 (= D104), D165 (= D130)
- binding phosphate ion: R32 (= R22), R36 (= R26), S72 (≠ D60), G221 (= G186), K252 (= K214)
Sites not aligning to the query:
Q01813 ATP-dependent 6-phosphofructokinase, platelet type; ATP-PFK; PFK-P; 6-phosphofructokinase type C; Phosphofructo-1-kinase isozyme C; PFK-C; Phosphohexokinase; EC 2.7.1.11 from Homo sapiens (Human) (see paper)
41% identity, 86% coverage: 3:277/320 of query aligns to 25:334/784 of Q01813
Sites not aligning to the query:
- 386 modified: Phosphoserine; S→A: Decreased interaction with ATG4B.
4rh3A Amppcp-bound structure of human platelet phosphofructokinase in an r- state, crystal form ii (see paper)
41% identity, 85% coverage: 5:277/320 of query aligns to 3:310/731 of 4rh3A
- active site: G10 (= G12), R73 (= R73), C74 (≠ F74), D104 (= D104), G148 (= G125), S149 (≠ T126), D151 (= D128), D153 (= D130), R195 (= R172)
- binding phosphomethylphosphonic acid adenylate ester: G9 (= G11), R73 (= R73), C74 (≠ F74), F77 (= F77), R78 (= R78), G103 (= G103), D104 (= D104), G105 (= G105), S106 (= S106), G109 (= G109)
- binding phosphate ion: K240 (= K214)
Sites not aligning to the query:
P08237 ATP-dependent 6-phosphofructokinase, muscle type; ATP-PFK; PFK-M; 6-phosphofructokinase type A; Phosphofructo-1-kinase isozyme A; PFK-A; Phosphohexokinase; EC 2.7.1.11 from Homo sapiens (Human) (see 6 papers)
41% identity, 87% coverage: 3:279/320 of query aligns to 16:327/780 of P08237
- R39 (= R26) to P: in GSD7; Italian; dbSNP:rs121918193
- G57 (= G44) to V: in GSD7; Italian
- R100 (≠ V85) to Q: in dbSNP:rs2228500
- S180 (≠ T142) to C: in GSD7; Italian
- G209 (= G171) to D: in GSD7; loss of activity shown by complementation assays in yeast; dbSNP:rs767265360
- D309 (= D261) to G: in GSD7; Spanish; complete loss of enzyme activity; dbSNP:rs1169383137
Sites not aligning to the query:
- 543 D → A: in GSD7; Italian; dbSNP:rs121918194
- 557 modified: N6-(2-hydroxyisobutyryl)lysine
- 591 D → A: in GSD7; Italian
- 686 W → C: in GSD7; Japanese; dbSNP:rs121918196
- 696 R → H: in dbSNP:rs41291971
O42938 ATP-dependent 6-phosphofructokinase; ATP-PFK; Phosphofructokinase; Phosphohexokinase; EC 2.7.1.11 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
40% identity, 86% coverage: 3:278/320 of query aligns to 195:506/942 of O42938
Sites not aligning to the query:
- 43 modified: Phosphoserine
- 45 modified: Phosphoserine
- 85 modified: Phosphoserine
- 160 modified: Phosphoserine
- 163 modified: Phosphoserine
- 167 modified: Phosphoserine
- 171 modified: Phosphoserine
- 175 modified: Phosphothreonine
- 600 modified: Phosphoserine
- 602 modified: Phosphothreonine
Query Sequence
>17955 b3916 6-phosphofructokinase (NCBI)
MIKKIGVLTSGGDAPGMNAAIRGVVRSALTEGLEVMGIYDGYLGLYEDRMVQLDRYSVSD
MINRGGTFLGSARFPEFRDENIRAVAIENLKKRGIDALVVIGGDGSYMGAMRLTEMGFPC
IGLPGTIDNDIKGTDYTIGFFTALSTVVEAIDRLRDTSSSHQRISVVEVMGRYCGDLTLA
AAIAGGCEFVVVPEVEFSREDLVNEIKAGIAKGKKHAIVAITEHMCDVDELAHFIEKETG
RETRATVLGHIQRGGSPVPYDRILASRMGAYAIDLLLAGYGGRCVGIQNEQLVHHDIIDA
IENMKRPFKGDWLDCAKKLY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory