SitesBLAST
Comparing 17966 FitnessBrowser__Keio:17966 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AER0 Glycerol uptake facilitator protein; Aquaglyceroporin; Glycerol facilitator from Escherichia coli (strain K12) (see 3 papers)
100% identity, 100% coverage: 1:281/281 of query aligns to 1:281/281 of P0AER0
- HLN 66:68 (= HLN 66:68) binding
- Y138 (= Y138) binding
- GFA 199:201 (= GFA 199:201) binding
- N203 (= N203) binding
- R206 (= R206) binding
- PL 236:237 (= PL 236:237) mutation to FW: No detectable water or glycerol permeability.
1fx8A Crystal structure of the e. Coli glycerol facilitator (glpf) with substrate glycerol (see paper)
100% identity, 90% coverage: 6:259/281 of query aligns to 1:254/254 of 1fx8A
B1VB61 Propanediol uptake facilitator PduF from Citrobacter freundii (see paper)
68% identity, 96% coverage: 3:271/281 of query aligns to 1:269/269 of B1VB61
P37451 Propanediol uptake facilitator PduF from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
68% identity, 93% coverage: 3:264/281 of query aligns to 1:262/264 of P37451
Q96PS8 Aquaporin-10; AQP-10; Aquaglyceroporin-10; Small intestine aquaporin from Homo sapiens (Human) (see 2 papers)
36% identity, 98% coverage: 5:278/281 of query aligns to 18:295/301 of Q96PS8
- E27 (= E14) mutation to Q: Abolishes permeability to glycerol.
- G73 (≠ T59) mutation to A: Increased permeability to glycerol at acidic pH.; mutation to F: Abolishes permeability to glycerol.
- S77 (= S63) mutation S->A,D: Nearly abolishes permeability to glycerol.
- H80 (= H66) mutation to A: Abolishes permeability to glycerol.
- F85 (≠ V71) mutation to A: Nearly abolishes permeability to glycerol.
- R94 (≠ C80) mutation to A: Abolishes permeability to glycerol.
- N133 (≠ H119) modified: carbohydrate, N-linked (GlcNAc...) asparagine; mutation to Q: Abolishes N-glycosylation.
6f7hC Crystal structure of human aqp10 (see paper)
38% identity, 90% coverage: 5:258/281 of query aligns to 3:252/253 of 6f7hC
O14520 Aquaporin-7; AQP-7; Aquaglyceroporin-7; Aquaporin adipose; AQPap; Aquaporin-7-like from Homo sapiens (Human) (see 4 papers)
33% identity, 93% coverage: 10:269/281 of query aligns to 36:290/342 of O14520
- V59 (= V34) to L: in dbSNP:rs4008659
- Y135 (= Y109) Important for permeability to glycerol; mutation to A: Strongly decreased permeability to glycerol. Mildly decreased water permeability.
- H165 (= H142) mutation to A: Decreased permeability to glycerol. Mildly decreased water permeability.
- G264 (= G243) to V: affects water and glycerol transport; dbSNP:rs62542743
Sites not aligning to the query:
- 1:32 mutation Missing: Decreased interaction with PLIN1.
- 12 R → C: in dbSNP:rs139297434
8c9hA Aqp7_inhibitor
34% identity, 88% coverage: 10:256/281 of query aligns to 11:252/253 of 8c9hA
6n1gA Crystal structure of aquaglyceroporin aqp7 (see paper)
34% identity, 88% coverage: 10:256/281 of query aligns to 5:246/249 of 6n1gA
I1CR68 Aquaporin-1 from Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) (Mucormycosis agent) (Rhizopus arrhizus var. delemar) (see paper)
37% identity, 88% coverage: 2:247/281 of query aligns to 49:292/306 of I1CR68
- H275 (≠ R228) mutation to A: Affects pH sensing; when associated with A-85.
3c02A X-ray structure of the aquaglyceroporin from plasmodium falciparum (see paper)
37% identity, 88% coverage: 10:255/281 of query aligns to 5:235/242 of 3c02A
2evuA Crystal structure of aquaporin aqpm at 2.3a resolution (see paper)
34% identity, 89% coverage: 6:254/281 of query aligns to 3:243/245 of 2evuA
P08995 Nodulin-26; N-26 from Glycine max (Soybean) (Glycine hispida) (see paper)
32% identity, 86% coverage: 10:252/281 of query aligns to 39:245/271 of P08995
Sites not aligning to the query:
- 262 modified: Phosphoserine; by CPK
Q6Z2T3 Aquaporin NIP2-1; Low silicon protein 1; NOD26-like intrinsic protein 2-1; OsNIP2;1; Silicon influx transporter LSI1 from Oryza sativa subsp. japonica (Rice) (see paper)
28% identity, 87% coverage: 7:251/281 of query aligns to 47:254/298 of Q6Z2T3
- A132 (≠ S92) mutation to T: In lsi; impairs silicon uptake. Grain discoloration. Reduces grain yield 10-fold.
P41181 Aquaporin-2; AQP-2; ADH water channel; Aquaporin-CD; AQP-CD; Collecting duct water channel protein; WCH-CD; Water channel protein for renal collecting duct from Homo sapiens (Human) (see 12 papers)
31% identity, 95% coverage: 13:278/281 of query aligns to 15:249/271 of P41181
- G64 (= G64) to R: in NDI2; loss of water channel activity; dbSNP:rs104894326
- G78 (≠ F78) mutation to A: Does not affect interaction with MIAC; when associated with A-79.
- C79 (≠ A79) mutation to A: Does not affect interaction with MIAC; when associated with A-78.
- S148 (≠ L166) mutation to A: No effect on sorting from the ER to the vesicles, redistribution to apical membrane, or endocytosis.; mutation to D: Retained in the endoplasmic reticulum.
- R187 (= R206) to C: in NDI2; loss of water channel activity; mutant protein does not fold properly; dbSNP:rs104894328
- A190 (≠ G209) to T: in NDI2; mutant protein does not fold properly and is not functional; dbSNP:rs104894341
- V194 (≠ F224) to I: in dbSNP:rs772051028
- S216 (≠ A248) to P: in NDI2; loss of water channel activity; dbSNP:rs104894329
- L217 (≠ F249) mutation to A: Abolishes interaction with MIAC; when associated with A-221.
- Y221 (≠ K253) mutation to A: Abolishes interaction with MIAC; when associated with A-217.
- S229 (≠ H258) mutation to A: No effect on sorting from the ER to the vesicles, redistribution to apical membrane, or endocytosis.; mutation to D: No effect on sorting from the ER to the vesicles, redistribution to apical membrane, or endocytosis.
- S231 (≠ P260) mutation to A: No effect on sorting from the ER to the vesicles, redistribution to apical membrane, or endocytosis.; mutation to D: No effect on sorting from the ER to the vesicles, redistribution to apical membrane, or endocytosis.
- E232 (≠ C261) mutation to A: Reduces interaction with MIAC.
- T244 (= T273) mutation to A: No effect on sorting from the ER to the vesicles, redistribution to apical membrane, or endocytosis.; mutation to E: No effect on sorting from the ER to the vesicles, redistribution to apical membrane, or endocytosis.
Sites not aligning to the query:
- 254 R → L: in NDI2; results in the loss of arginine vasopressin-mediated phosphorylation at S-256; R → Q: in NDI2; exerts a dominant-negative effect on wild-type-AQP2 in that it interferes with its trafficking to the apical membrane; is a loss of function instead of a gain of function mutation on dominant nephrogenic diabetes insipidus
- 256 modified: Phosphoserine; by PKA; S→A: Retained in vesicles.; S→D: Expressed in the apical membrane.
- 258 E → K: in NDI2; retained in the Golgi compartment; dbSNP:rs104894332
- 262 P → L: in NDI2; mutant protein folds properly and is functional but is retained in intracellular vesicles; able to assemble into tetramers with wild-type AQP2 that properly localize to the apical membrane; dbSNP:rs104894339; P→A: No effect on expression at the apical cell membrane.
P56402 Aquaporin-2; AQP-2; ADH water channel; Aquaporin-CD; AQP-CD; Collecting duct water channel protein; WCH-CD; Water channel protein for renal collecting duct from Mus musculus (Mouse) (see 2 papers)
31% identity, 95% coverage: 12:278/281 of query aligns to 14:249/271 of P56402
- T126 (≠ V146) mutation to M: Does not cause loss of water channel activity, but impairs trafficking from cytoplasmic vesicles to the cell membrane.
Sites not aligning to the query:
- 256 modified: Phosphoserine; S → L: in cph; loss of a phosphorylation site and loss of trafficking to the apical cell membrane; causes aberrant location at the basolateral cell membrane
4nefA X-ray structure of human aquaporin 2 (see paper)
32% identity, 86% coverage: 13:255/281 of query aligns to 14:222/239 of 4nefA
Q9SAI4 Aquaporin NIP6-1; NOD26-like intrinsic protein 6-1; AtNIP6;1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 95% coverage: 13:279/281 of query aligns to 84:302/305 of Q9SAI4
- A119 (≠ W48) mutation to W: 6-fold increase in water transport activity, but impaired in urea transport.
- V252 (≠ A205) mutation to A: No effect.
Q08733 Aquaporin PIP1-3; AtPIP1;3; Plasma membrane intrinsic protein 1c; PIP1c; Transmembrane protein B; TMP-B from Arabidopsis thaliana (Mouse-ear cress) (see paper)
28% identity, 89% coverage: 12:260/281 of query aligns to 55:281/286 of Q08733
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
P55064 Aquaporin-5; AQP-5 from Homo sapiens (Human) (see 2 papers)
31% identity, 94% coverage: 13:277/281 of query aligns to 16:248/265 of P55064
- A38 (= A37) to E: in PPKB; retains the ability to traffic to the cell membrane; dbSNP:rs398123054
- I45 (= I44) to S: in PPKB; retains the ability to traffic to the cell membrane; dbSNP:rs398123055
- N123 (≠ A132) to D: in PPKB; retains the ability to traffic to the cell membrane; dbSNP:rs398123057
- S156 (≠ V173) mutation to A: No effect on location at the cell membrane.; mutation to E: Increased location at the cell membrane.
- I177 (vs. gap) to F: in PPKB; retains the ability to traffic to the cell membrane; dbSNP:rs398123056
- R188 (= R206) to C: in PPKB; retains the ability to traffic to the cell membrane; dbSNP:rs368292687
Query Sequence
>17966 FitnessBrowser__Keio:17966
MSQTSTLKGQCIAEFLGTGLLIFFGVGCVAALKVAGASFGQWEISVIWGLGVAMAIYLTA
GVSGAHLNPAVTIALWLFACFDKRKVIPFIVSQVAGAFCAAALVYGLYYNLFFDFEQTHH
IVRGSVESVDLAGTFSTYPNPHINFVQAFAVEMVITAILMGLILALTDDGNGVPRGPLAP
LLIGLLIAVIGASMGPLTGFAMNPARDFGPKVFAWLAGWGNVAFTGGRDIPYFLVPLFGP
IVGAIVGAFAYRKLIGRHLPCDICVVEEKETTTPSEQKASL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory