Comparing 18105 FitnessBrowser__Keio:18105 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
34% identity, 96% coverage: 2:419/437 of query aligns to 1:420/424 of 6zl4A
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
34% identity, 96% coverage: 2:419/437 of query aligns to 2:421/425 of 6zgbA
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
34% identity, 96% coverage: 2:419/437 of query aligns to 4:423/426 of 6xwnB
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
34% identity, 96% coverage: 2:419/437 of query aligns to 4:423/427 of 5e9sA
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
34% identity, 95% coverage: 2:417/437 of query aligns to 6:421/425 of O59010
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
35% identity, 95% coverage: 6:419/437 of query aligns to 1:412/416 of 6r7rA
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
34% identity, 94% coverage: 2:412/437 of query aligns to 6:416/419 of 6x15A
Sites not aligning to the query:
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
34% identity, 94% coverage: 2:412/437 of query aligns to 3:413/413 of 6x14A
2nwwA Crystal structure of gltph in complex with tboa (see paper)
34% identity, 92% coverage: 12:412/437 of query aligns to 11:407/407 of 2nwwA
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
34% identity, 93% coverage: 5:412/437 of query aligns to 1:408/409 of 6bavA
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
34% identity, 93% coverage: 5:412/437 of query aligns to 1:408/408 of 6bauA
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
32% identity, 93% coverage: 5:412/437 of query aligns to 1:396/396 of 6bmiA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
30% identity, 92% coverage: 19:419/437 of query aligns to 33:409/412 of 7awmA
Q10901 Excitatory amino acid transporter; Sodium-dependent glutamate/ aspartate transporter from Caenorhabditis elegans (see paper)
27% identity, 87% coverage: 45:425/437 of query aligns to 56:469/503 of Q10901
7xr4A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with glutamate (see paper)
30% identity, 92% coverage: 2:402/437 of query aligns to 7:405/425 of 7xr4A
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
30% identity, 92% coverage: 2:402/437 of query aligns to 8:404/424 of 7xr6A
P56564 Excitatory amino acid transporter 1; Glial high affinity glutamate transporter; High-affinity neuronal glutamate transporter; GluT-1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Mus musculus (Mouse) (see paper)
28% identity, 91% coverage: 15:413/437 of query aligns to 57:496/543 of P56564
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
28% identity, 92% coverage: 19:419/437 of query aligns to 25:395/397 of 5mjuA
P31596 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; GLUT-R; Solute carrier family 1 member 2 from Rattus norvegicus (Rat) (see paper)
28% identity, 92% coverage: 2:402/437 of query aligns to 43:486/573 of P31596
P43006 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; Solute carrier family 1 member 2 from Mus musculus (Mouse) (see paper)
28% identity, 92% coverage: 2:402/437 of query aligns to 43:486/572 of P43006
Sites not aligning to the query:
>18105 FitnessBrowser__Keio:18105
MKNIKFSLAWQILFAMVLGILLGSYLHYHSDSRDWLVVNLLSPAGDIFIHLIKMIVVPIV
ISTLVVGIAGVGDAKQLGRIGAKTIIYFEVITTVAIILGITLANVFQPGAGVDMSQLATV
DISKYQSTTEAVQSSSHGIMGTILSLVPTNIVASMAKGEMLPIIFFSVLFGLGLSSLPAT
HREPLVTVFRSISETMFKVTHMVMRYAPVGVFALIAVTVANFGFSSLWPLAKLVLLVHFA
ILFFALVVLGIVARLCGLSVWILIRILKDELILAYSTASSESVLPRIIEKMEAYGAPVSI
TSFVVPTGYSFNLDGSTLYQSIAAIFIAQLYGIDLSIWQEIILVLTLMVTSKGIAGVPGV
SFVVLLATLGSVGIPLEGLAFIAGVDRILDMARTALNVVGNALAVLVIAKWEHKFDRKKA
LAYEREVLGKFDKTADQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory