SitesBLAST
Comparing 18139 FitnessBrowser__Keio:18139 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
P25297 Inorganic phosphate transporter PHO84 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
25% identity, 75% coverage: 16:388/500 of query aligns to 52:483/587 of P25297
- K298 (vs. gap) modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Sites not aligning to the query:
- 6 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
24% identity, 76% coverage: 39:419/500 of query aligns to 56:412/444 of Q8NLB7
- D57 (= D40) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- R103 (≠ K92) mutation to A: Loss of transport activity.
- W309 (≠ L317) mutation to V: Loss of transport activity.
- D312 (= D320) mutation to A: Loss of transport activity.
- R313 (= R321) mutation to A: Loss of transport activity.
- I317 (vs. gap) mutation I->H,Y: Loss of transport activity.
- R386 (≠ V397) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 54 D→A: Loss of transport activity.; D→E: Retains 50% of its transport activity.
P36035 Carboxylic acid transporter protein homolog from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
23% identity, 67% coverage: 77:412/500 of query aligns to 186:516/616 of P36035
- K338 (≠ G241) modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 9 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
25% identity, 35% coverage: 81:256/500 of query aligns to 98:279/583 of Q9Y7Q9
- S267 (≠ D244) modified: Phosphoserine
- S269 (≠ P246) modified: Phosphoserine
Sites not aligning to the query:
- 289 modified: Phosphoserine
- 290 modified: Phosphoserine
- 292 modified: Phosphoserine
- 330 modified: Phosphoserine
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
23% identity, 47% coverage: 87:322/500 of query aligns to 78:316/452 of Q5EXK5
- D82 (= D91) mutation to A: Loss of activity.
- V311 (≠ L317) mutation to W: Loss of activity.
- D314 (= D320) mutation to A: Loss of activity.
8bvtA Cryo-em structure of rat slc22a6 bound to probenecid (see paper)
22% identity, 73% coverage: 81:446/500 of query aligns to 138:497/508 of 8bvtA
Sites not aligning to the query:
8bvsA Cryo-em structure of rat slc22a6 bound to tenofovir (see paper)
22% identity, 73% coverage: 81:446/500 of query aligns to 129:488/502 of 8bvsA
8bw7A Cryo-em structure of rat slc22a6 bound to alpha-ketoglutaric acid (see paper)
23% identity, 73% coverage: 81:446/500 of query aligns to 129:484/497 of 8bw7A
O57379 Solute carrier family 22 member 6; Organic anion transporter 1; Renal organic anion transporter 1; ROAT1; fROAT1 from Pseudopleuronectes americanus (Winter flounder) (Pleuronectes americanus) (see paper)
24% identity, 25% coverage: 81:206/500 of query aligns to 159:272/562 of O57379
Sites not aligning to the query:
- 34 H→I: Reduced transport activity.
- 394 K→A: Reduced transport activity.
- 478 R→D: Reduced transport activity.
6rw3A The molecular basis for sugar import in malaria parasites. (see paper)
22% identity, 53% coverage: 130:392/500 of query aligns to 99:385/437 of 6rw3A
Q8VC69 Solute carrier family 22 member 6; Kidney-specific transport protein; Novel kidney transcript; mNKT; Organic anion transporter 1; mOAT1; Renal organic anion transporter 1; mROAT1 from Mus musculus (Mouse) (see 2 papers)
25% identity, 25% coverage: 81:207/500 of query aligns to 141:255/545 of Q8VC69
- C183 (≠ G123) mutation to A: Decreased cell surface expression level and PAH transport activity. Complete loss of PAH transport activity; when associated with A-49; A-78; A-99; A-122; A-172; A-200; A-362; A-335; A-379; A-402; A-427 and A-434.
Sites not aligning to the query:
- 39 N→Q: Complete loss of PAH transport activity.
- 49 C→A: Decreased cell surface expression level and PAH transport activity. Complete loss of PAH transport activity; when associated with A-78; A-99; A-122; A-172; A-183; A-200; A-362; A-335; A-379; A-402; A-427 and A-434.
- 56 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 86 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 91 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 107 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 122 C→A: Decreased cell surface expression level and PAH transport activity. Complete loss of PAH transport activity; when associated with A-49; A-78; A-99; A-172; A-183; A-200; A-362; A-335; A-379; A-402; A-427 and A-434.
- 434 C→A: Decreased cell surface expression level and PAH transport activity. 80% decrease of PAH transport activity; when associated with A-49; A-122 and A-183. Complete loss of PAH transport activity; when associated with A-49; A-78; A-99; A-122; A-172; A-183; A-200; A-362; A-335; A-379; A-402 and A-427.
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
24% identity, 73% coverage: 30:392/500 of query aligns to 17:411/491 of P0AGF4
- F24 (≠ E37) mutation to A: Decreases xylose transport.
- G83 (= G94) mutation to A: Abolishes xylose transport.
- R133 (≠ K134) mutation R->C,H,L: Abolishes xylose transport.
- E153 (= E154) mutation to A: Abolishes xylose transport.
- R160 (= R161) mutation to A: Abolishes xylose transport.
- Q168 (≠ D169) binding ; mutation to A: Abolishes xylose transport.
- Q288 (≠ A270) mutation to A: Abolishes xylose transport.
- QQ 288:289 (≠ AT 270:271) binding
- Q289 (≠ T271) mutation to A: Strongly decreases xylose transport.
- N294 (≠ Y276) binding ; mutation to A: Abolishes xylose transport.
- Y298 (≠ T280) mutation to A: Abolishes xylose transport.
- N325 (≠ G307) mutation to A: No effect on xylose transport.
- G340 (= G323) mutation to A: Abolishes xylose transport.
- R341 (= R324) mutation R->A,W: Abolishes xylose transport.
- W392 (≠ A373) binding ; mutation to A: Abolishes xylose transport.
- E397 (≠ A378) mutation to A: Abolishes xylose transport.
- R404 (= R385) mutation to A: Strongly decreases xylose transport.
Sites not aligning to the query:
- 415 binding
- 416 W→A: Strongly decreases xylose transport.
Query Sequence
>18139 FitnessBrowser__Keio:18139
MLKRKKVKPITLRDVTIIDDGKLRKAITAASLGNAMEWFDFGVYGFVAYALGKVFFPGAD
PSVQMVAALATFSVPFLIRPLGGLFFGMLGDKYGRQKILAITIVIMSISTFCIGLIPSYD
TIGIWAPILLLICKMAQGFSVGGEYTGASIFVAEYSPDRKRGFMGSWLDFGSIAGFVLGA
GVVVLISTIVGEANFLDWGWRIPFFIALPLGIIGLYLRHALEETPAFQQHVDKLEQGDRE
GLQDGPKVSFKEIATKYWRSLLTCIGLVIATNVTYYMLLTYMPSYLSHNLHYSEDHGVLI
IIAIMIGMLFVQPVMGLLSDRFGRRPFVLLGSVALFVLAIPAFILINSNVIGLIFAGLLM
LAVILNCFTGVMASTLPAMFPTHIRYSALAAAFNISVLVAGLTPTLAAWLVESSQNLMMP
AYYLMVVAVVGLITGVTMKETANRPLKGATPAASDIQEAKEILVEHYDNIEQKIDDIDHE
IADLQAKRTRLVQQHPRIDE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory