SitesBLAST
Comparing 18174 FitnessBrowser__Keio:18174 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
Q9XBQ8 L-lysine 2,3-aminomutase; LAM; KAM; EC 5.4.3.2 from Clostridium subterminale (see paper)
33% identity, 94% coverage: 14:335/342 of query aligns to 19:340/416 of Q9XBQ8
- E86 (= E82) mutation to Q: Reduction in activity. Decrease in iron and sulfide and PLP content.
- D96 (= D92) mutation to N: Reduction in activity. Decrease in iron and sulfide and PLP content.
- R130 (= R125) mutation R->Q,K: Complete loss of activity. Decrease in iron and sulfide but not PLP content. Destabilise the iron-sulfur centers.
- R134 (= R129) mutation to K: Complete loss of activity. Significant decrease in iron and sulfide and PLP content.; mutation to Q: Complete loss of activity. Slight decrease in iron and sulfide and PLP content.
- R135 (= R130) mutation to K: Reduction in activity. Decrease in iron and sulfide and PLP content.; mutation to Q: Reduction in activity. Significant decrease in iron and sulfide and PLP content.
- R136 (≠ H131) mutation to Q: Reduction in activity. Significant decrease in iron and sulfide and PLP content.
- D165 (≠ E159) mutation to N: Significant reduction in activity. Decrease in iron and sulfide and PLP content.
- D172 (= D166) mutation to N: Complete loss of activity. Decrease in iron and sulfide and PLP content. Destabilise the iron-sulfur centers.
- E236 (= E231) mutation to Q: Significant reduction in activity. Decrease in iron and sulfide and PLP content.
- D293 (= D288) mutation to N: Complete loss of activity. Decrease in iron and sulfide and PLP content.
- D330 (≠ E325) mutation D->A,N: Complete loss of activity. Decrease in iron and sulfide and PLP content.
2a5hB 2.1 angstrom x-ray crystal structure of lysine-2,3-aminomutase from clostridium subterminale sb4, with michaelis analog (l-alpha-lysine external aldimine form of pyridoxal-5'-phosphate). (see paper)
33% identity, 94% coverage: 14:335/342 of query aligns to 17:338/410 of 2a5hB
- active site: R110 (≠ K107), Y111 (= Y108), R114 (= R111), C123 (= C120), C127 (= C124), C130 (= C127), R132 (= R129), D291 (= D288), D328 (≠ E325), K335 (= K332)
- binding lysine: L96 (= L94), L116 (= L113), R132 (= R129), L165 (≠ I161), S167 (= S163), Y288 (≠ H285), D291 (= D288), D328 (≠ E325)
- binding pyridoxal-5'-phosphate: T108 (≠ L105), Y111 (= Y108), R114 (= R111), L116 (= L113), R196 (= R192), Y285 (= Y282), Y286 (= Y283), K335 (= K332)
- binding s-adenosylmethionine: H129 (≠ Y126), T131 (≠ F128), R132 (= R129), S167 (= S163), G169 (= G165), G198 (≠ H194), H228 (= H225), Q256 (= Q253), V258 (= V255), Y288 (≠ H285), C290 (≠ L287), D291 (= D288)
- binding iron/sulfur cluster: C123 (= C120), C127 (= C124), C130 (= C127), G169 (= G165), R200 (= R196), H228 (= H225)
Sites not aligning to the query:
O34676 L-lysine 2,3-aminomutase; LAM; KAM; EC 5.4.3.2 from Bacillus subtilis (strain 168) (see paper)
33% identity, 94% coverage: 14:335/342 of query aligns to 28:349/471 of O34676
- K290 (≠ D276) mutation to Q: More than 95% loss of activity, and half of normal PLP binding capacity.
- K346 (= K332) mutation to Q: No activity and no bound PLP.
Sites not aligning to the query:
- 361 K→Q: 95% loss of activity, normal PLP binding capacity.
Query Sequence
>18174 FitnessBrowser__Keio:18174
MAHIVTLNTPSREDWLTQLADVVTDPDELLRLLNIDAEEKLLAGRSAKKLFALRVPRSFI
DRMEKGNPDDPLLRQVLTSQDEFVIAPGFSTDPLEEQHSVVPGLLHKYHNRALLLVKGGC
AVNCRYCFRRHFPYAENQGNKRNWQTALEYVAAHPELDEMIFSGGDPLMAKDHELDWLLT
QLEAIPHIKRLRIHSRLPIVIPARITEALVECFARSTLQILLVNHINHANEVDETFRQAM
AKLRRVGVTLLNQSVLLRDVNDNAQTLANLSNALFDAGVMPYYLHVLDKVQGAAHFMVSD
DEARQIMRELLTLVSGYLVPKLAREIGGEPSKTPLDLQLRQQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory