Comparing 18252 FitnessBrowser__Keio:18252 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P39325 Galactofuranose-binding protein YtfQ from Escherichia coli (strain K12) (see 2 papers)
100% identity, 100% coverage: 1:318/318 of query aligns to 1:318/318 of P39325
2vk2A Crystal structure of a galactofuranose binding protein (see paper)
100% identity, 93% coverage: 23:318/318 of query aligns to 1:296/296 of 2vk2A
5ocpA The periplasmic binding protein component of the arabinose abc transporter from shewanella sp. Ana-3 bound to alpha and beta-l- arabinofuranose
60% identity, 92% coverage: 25:316/318 of query aligns to 2:291/302 of 5ocpA
6hbdA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with beta-d-galactofuranose (see paper)
47% identity, 91% coverage: 24:313/318 of query aligns to 3:284/305 of 6hbdA
Sites not aligning to the query:
6hyhA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with beta-d-fucofuranose (see paper)
47% identity, 91% coverage: 24:313/318 of query aligns to 2:283/304 of 6hyhA
Sites not aligning to the query:
6hbmA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with alpha-l-arabinofuranose (see paper)
47% identity, 91% coverage: 24:313/318 of query aligns to 2:283/304 of 6hbmA
Sites not aligning to the query:
7e7mC Crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb
36% identity, 83% coverage: 49:312/318 of query aligns to 34:281/284 of 7e7mC
Sites not aligning to the query:
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
36% identity, 78% coverage: 43:290/318 of query aligns to 20:258/274 of 2ioyA
Sites not aligning to the query:
1dbpA Identical mutations at corresponding positions in two homologous proteins with non-identical effects (see paper)
33% identity, 72% coverage: 45:274/318 of query aligns to 23:241/271 of 1dbpA
Sites not aligning to the query:
2x7xA Fructose binding periplasmic domain of hybrid two component system bt1754 (see paper)
32% identity, 72% coverage: 24:251/318 of query aligns to 2:220/301 of 2x7xA
2fn8A Thermotoga maritima ribose binding protein ribose bound form (see paper)
29% identity, 82% coverage: 37:296/318 of query aligns to 15:274/292 of 2fn8A
Sites not aligning to the query:
4zjpA Structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose
30% identity, 72% coverage: 45:274/318 of query aligns to 24:241/270 of 4zjpA
Sites not aligning to the query:
A0QYB5 D-threitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
33% identity, 65% coverage: 68:273/318 of query aligns to 78:280/349 of A0QYB5
Sites not aligning to the query:
4rs3A Crystal structure of carbohydrate transporter a0qyb3 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with xylitol (see paper)
33% identity, 70% coverage: 68:290/318 of query aligns to 45:262/315 of 4rs3A
Sites not aligning to the query:
A0QYB3 Xylitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
33% identity, 70% coverage: 68:290/318 of query aligns to 78:295/349 of A0QYB3
Sites not aligning to the query:
5hkoA Crystal structure of abc transporter solute binding protein msmeg_3598 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with l-sorbitol
33% identity, 70% coverage: 68:290/318 of query aligns to 45:262/314 of 5hkoA
Sites not aligning to the query:
4rsmA Crystal structure of carbohydrate transporter msmeg_3599 from mycobacterium smegmatis str. Mc2 155, target efi-510970, in complex with d-threitol (see paper)
33% identity, 65% coverage: 68:273/318 of query aligns to 46:248/315 of 4rsmA
Sites not aligning to the query:
4yo7A Crystal structure of an abc transporter solute binding protein (ipr025997) from bacillus halodurans c-125 (bh2323, target efi- 511484) with bound myo-inositol
28% identity, 66% coverage: 58:266/318 of query aligns to 41:241/287 of 4yo7A
Sites not aligning to the query:
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
30% identity, 71% coverage: 45:270/318 of query aligns to 24:248/287 of 5dteB
Sites not aligning to the query:
4ry9B Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
27% identity, 66% coverage: 26:235/318 of query aligns to 5:216/297 of 4ry9B
Sites not aligning to the query:
>18252 FitnessBrowser__Keio:18252
MWKRLLIVSAVSAAMSSMALAAPLTVGFSQVGSESGWRAAETNVAKSEAEKRGITLKIAD
GQQKQENQIKAVRSFVAQGVDAIFIAPVVATGWEPVLKEAKDAEIPVFLLDRSIDVKDKS
LYMTTVTADNILEGKLIGDWLVKEVNGKPCNVVELQGTVGASVAIDRKKGFAEAIKNAPN
IKIIRSQSGDFTRSKGKEVMESFIKAENNGKNICMVYAHNDDMVIGAIQAIKEAGLKPGK
DILTGSIDGVPDIYKAMMDGEANASVELTPNMAGPAFDALEKYKKDGTMPEKLTLTKSTL
YLPDTAKEELEKKKNMGY
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory