SitesBLAST
Comparing 18274 FitnessBrowser__Keio:18274 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P39333 Cyclic-di-GMP-binding biofilm dispersal mediator protein from Escherichia coli (strain K12) (see paper)
100% identity, 100% coverage: 1:237/237 of query aligns to 1:237/237 of P39333
- E50 (= E50) mutation E->Q,V: Shows higher affinity for cyclic-di-GMP, increases swimming motility and biofilm dispersal. Biofilm formation is almost completely removed.
5z2lK Crystal structure of bdca in complex with NADPH (see paper)
100% identity, 100% coverage: 2:237/237 of query aligns to 1:236/244 of 5z2lK
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S14 (= S15), R15 (= R16), I17 (= I18), Y36 (= Y37), A37 (= A38), G38 (= G39), S39 (= S40), T57 (= T58), D58 (= D59), S59 (= S60), N81 (= N82), A82 (= A83), G83 (= G84), I129 (= I130), S131 (= S132), Y145 (= Y146), K149 (= K150), P175 (= P176), I178 (= I179), T180 (= T181), A182 (= A183), N183 (= N184)
5wuwA Serratia marcescens short-chain dehydrogenase/reductase f98l/f202l mutant (see paper)
51% identity, 99% coverage: 4:237/237 of query aligns to 3:245/245 of 5wuwA
- active site: G16 (= G17), S140 (= S132), Y154 (= Y146), L161 (= L153)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), R15 (= R16), I17 (= I18), Y36 (= Y37), A37 (= A38), A38 (≠ G39), D63 (= D59), S64 (= S60), N90 (= N82), A91 (= A83), G92 (= G84), Y154 (= Y146), K158 (= K150), G185 (= G177), P186 (= P178), V187 (≠ I179)
6j7uA Crystal structure of blue fluorescent protein from metagenomic library in complex with NADPH (see paper)
50% identity, 99% coverage: 4:237/237 of query aligns to 3:247/247 of 6j7uA
- active site: G16 (= G17), S142 (= S132), Y156 (= Y146)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (= S15), R15 (= R16), I17 (= I18), Y36 (= Y37), V37 (vs. gap), S38 (vs. gap), S41 (= S40), D65 (= D59), S66 (= S60), N92 (= N82), A93 (= A83), G94 (= G84), I115 (= I105), G141 (= G131), S142 (= S132), Y156 (= Y146), K160 (= K150), P186 (= P176), T191 (= T181), M193 (≠ A183), N194 (= N184)
5u2wA Crystal structure of a short chain dehydrogenase from burkholderia cenocepacia j2315 in complex with NADP
48% identity, 98% coverage: 1:233/237 of query aligns to 1:242/246 of 5u2wA
- active site: G17 (= G17), S141 (= S132), M152 (= M143), Y155 (= Y146), K159 (= K150)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G13 (= G13), S15 (= S15), R16 (= R16), G17 (= G17), I18 (= I18), Y37 (= Y37), E38 (≠ A38), K39 (≠ G39), S40 (= S40), A63 (≠ T58), D64 (= D59), S65 (= S60), N91 (= N82), A92 (= A83), G93 (= G84), T139 (≠ I130), Y155 (= Y146), K159 (= K150), P185 (= P176), G186 (= G177), T188 (≠ I179), T190 (= T181), M192 (≠ A183), N193 (= N184)
2d1yA Crystal structure of tt0321 from thermus thermophilus hb8 (see paper)
38% identity, 100% coverage: 2:237/237 of query aligns to 1:238/240 of 2d1yA
- active site: G16 (= G17), S135 (= S132), N145 (≠ M143), Y148 (= Y146), K152 (= K150)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), R15 (= R16), I17 (= I18), D36 (≠ G39), L37 (≠ S40), R38 (≠ K41), V55 (≠ T58), D56 (= D59), L57 (≠ S60), N83 (= N82), A84 (= A83), A85 (≠ G84), I86 (= I85), V133 (≠ I130), S135 (= S132), Y148 (= Y146), K152 (= K150), P178 (= P176), G179 (= G177), I181 (= I179), T183 (= T181), A185 (= A183), V186 (≠ N184)
P9WGT3 3-oxoacyl-[acyl-carrier-protein] reductase MabA; 3-ketoacyl reductase; 3-ketoacyl-acyl carrier protein reductase; Acetoacetyl-CoA reductase; Beta-ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; Mycolic acid biosynthesis A; EC 1.1.1.100; EC 1.1.1.36 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 7 papers)
35% identity, 98% coverage: 4:236/237 of query aligns to 13:244/247 of P9WGT3
- T21 (≠ L12) modified: Phosphothreonine; mutation to A: Slight decrease in phosphorylation by PknB. Lack of phosphorylation by PknB; when associated with A-114 and A-191.
- RGI 25:27 (= RGI 16:18) binding
- R47 (≠ A38) binding
- C60 (≠ T51) mutation to V: Displays a lower activity than the wild-type and a slightly decreased affinity for the cofactor. Retains 84% of activity; when associated with L-144. Totally inactive; when associated with A-139 and L-144.
- DV 61:62 (≠ GA 52:53) binding
- G90 (= G84) binding
- T114 (≠ H108) modified: Phosphothreonine; mutation to A: Slight decrease in phosphorylation by PknB. Lack of phosphorylation by PknB; when associated with A-21 and A-191.
- G139 (= G131) mutation to A: Complete protein inactivation and freezes the catalytic site into its closed form. Totally inactive; when associated with V-60 and L-144.
- S140 (= S132) mutation to A: Loss of activity. Can still bind NADPH.; mutation to T: Loss of activity. Impaired NADPH binding.
- S144 (≠ D136) mutation to L: Stabilizes the catalytic loop in its open active form. Retains 84% of activity; when associated with V-60. Totally inactive; when associated with V-60 and A-139.
- Y185 (≠ P178) mutation to L: 70% decrease in activity with acetoacetyl-CoA as substrate. Does not affect NADP binding.
- T191 (≠ N184) modified: Phosphothreonine; mutation to A: Retains 22% of wild-type reductase activity. Strong decrease in phosphorylation by PknB. Lack of phosphorylation by PknB; when associated with A-21 and A-114.; mutation to D: Phosphomimetic mutant that retains less than 10% of wild-type reductase activity. Impaired NADPH binding. Overproduction of the mutant leads to a significant inhibition of de novo biosynthesis of mycolic acids.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
5ovlA Crystal structure of maba bound to NADP+ from m. Smegmatis (see paper)
37% identity, 99% coverage: 3:236/237 of query aligns to 6:238/241 of 5ovlA
- active site: G20 (= G17), S134 (= S132), Y147 (= Y146), L154 (= L153)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G16 (= G13), N18 (≠ S15), R19 (= R16), G20 (= G17), I21 (= I18), R41 (≠ A38), D55 (≠ V56), V56 (≠ F57), N82 (= N82), A83 (= A83), I85 (= I85), T105 (≠ I105), I132 (= I130), S134 (= S132), Y147 (= Y146), K151 (= K150), P177 (= P176), G178 (= G177), I180 (= I179)
5ovkA Crystal structure maba bound to NADPH from m. Smegmatis (see paper)
37% identity, 99% coverage: 3:236/237 of query aligns to 7:239/242 of 5ovkA
P71534 3-oxoacyl-[acyl-carrier-protein] reductase MabA; 3-ketoacyl-acyl carrier protein reductase; Acetoacetyl-CoA reductase; Beta-ketoacyl-ACP reductase; Beta-ketoacyl-acyl carrier protein reductase; EC 1.1.1.100; EC 1.1.1.36 from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
37% identity, 99% coverage: 3:236/237 of query aligns to 20:252/255 of P71534
1uznA Maba from mycobacterium tuberculosis (see paper)
35% identity, 98% coverage: 4:236/237 of query aligns to 5:236/239 of 1uznA
- active site: G18 (= G17), S132 (= S132), Y145 (= Y146), K149 (= K150)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G14 (= G13), N16 (≠ S15), R17 (= R16), I19 (= I18), R39 (≠ A38), D53 (≠ G52), V54 (≠ A53), A81 (= A83), G82 (= G84)
P0A2C9 3-oxoacyl-[acyl-carrier-protein] reductase FabG; 3-ketoacyl-acyl carrier protein reductase; Beta-Ketoacyl-acyl carrier protein reductase; Beta-ketoacyl-ACP reductase; EC 1.1.1.100 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
38% identity, 97% coverage: 3:233/237 of query aligns to 2:239/244 of P0A2C9
- M125 (= M121) mutation to I: Loss of the temperature-sensitive phenotype; when associated with T-223.
- A223 (= A217) mutation to T: Loss of the temperature-sensitive phenotype; when associated with I-125.
- S224 (≠ G218) mutation to F: Distorts the local conformation and prevent stacking around Phe-221. The S224F mutation would additionally disrupt the hydrogen bond formed between Ser-224 and Glu-226.
6t77A Crystal structure of klebsiella pneumoniae fabg(NADPH-dependent) NADP- complex at 1.75 a resolution (see paper)
38% identity, 97% coverage: 3:233/237 of query aligns to 2:239/244 of 6t77A
- active site: G16 (= G17), S138 (= S132), Y151 (= Y146)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G12 (= G13), S14 (= S15), R15 (= R16), T37 (≠ G39), L58 (vs. gap), N59 (vs. gap), V60 (≠ F57), A87 (= A83), G88 (= G84), I89 (= I85)
7emgB Carbonyl reductase variant 4 (r123c/l209p/f183y/v61k) from serratia marcescens complexed with NADP+ (see paper)
38% identity, 97% coverage: 3:233/237 of query aligns to 1:238/243 of 7emgB
7xqmB Indel-mutant short chain dehydrogenase bound to sah (see paper)
37% identity, 100% coverage: 1:237/237 of query aligns to 1:244/253 of 7xqmB
- binding s-adenosyl-l-homocysteine: G13 (= G13), I16 (= I18), D34 (≠ G39), L35 (≠ S40), R36 (≠ K41), V53 (≠ T58), L55 (≠ S60), N81 (= N82), A82 (= A83), A83 (≠ G84), Y146 (= Y146)
1g6kA Crystal structure of glucose dehydrogenase mutant e96a complexed with NAD+
32% identity, 97% coverage: 4:233/237 of query aligns to 5:248/261 of 1g6kA
- active site: G18 (= G17), S145 (= S132), Y158 (= Y146), K162 (= K150)
- binding nicotinamide-adenine-dinucleotide: T17 (≠ R16), G18 (= G17), L19 (≠ I18), R39 (≠ A38), D65 (= D59), V66 (≠ S60), N92 (= N82), A93 (= A83), G94 (= G84), M143 (≠ I130), S145 (= S132), Y158 (= Y146), P188 (= P176), G189 (= G177), I191 (= I179), T193 (= T181)
P40288 Glucose 1-dehydrogenase; EC 1.1.1.47 from Priestia megaterium (Bacillus megaterium) (see 2 papers)
32% identity, 97% coverage: 4:233/237 of query aligns to 5:248/261 of P40288
- 11:35 (vs. 10:34, 40% identical) binding
- E96 (≠ G86) mutation E->A,G,K: Heat stable.
- D108 (= D98) mutation to N: Heat stable.
- V112 (≠ L102) mutation to A: Heat stable.
- E133 (= E123) mutation to K: Heat stable.
- V183 (≠ I171) mutation to I: Heat stable.
- P194 (≠ D182) mutation to Q: Heat stable.
- E210 (≠ H195) mutation to K: Heat stable.
- Y217 (≠ R202) mutation to H: Heat stable.
Sites not aligning to the query:
- 252 Q→L: Heat stable.
- 253 Y→C: Heat stable.
- 258 A→G: Heat stable.
4urfB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
35% identity, 98% coverage: 4:235/237 of query aligns to 3:245/248 of 4urfB
- active site: G16 (= G17), S142 (= S132), I152 (≠ M143), Y155 (= Y146), K159 (= K150)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: L210 (≠ I200), R211 (≠ K201), R212 (= R202)
- binding bicarbonate ion: I92 (= I85), G94 (= G86), R109 (= R101), R179 (≠ T170), S228 (≠ G218)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), G14 (≠ S15), N15 (≠ R16), G16 (= G17), I17 (= I18), D36 (≠ Y37), I37 (≠ A38), D62 (= D59), T63 (≠ S60), N89 (= N82), A90 (= A83), G91 (= G84), I140 (= I130), Y155 (= Y146), K159 (= K150), P185 (= P176), A186 (≠ G177), I188 (= I179), T190 (= T181)
4urfA Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
35% identity, 98% coverage: 4:235/237 of query aligns to 3:245/248 of 4urfA
- active site: G16 (= G17), S142 (= S132), I152 (≠ M143), Y155 (= Y146), K159 (= K150)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: I92 (= I85), S93 (vs. gap), G94 (= G86), E95 (≠ V87), T97 (≠ G89), E101 (= E93), T103 (≠ N95), Q106 (≠ D98), R109 (= R101), S175 (≠ P166), G177 (= G168)
- binding magnesium ion: S237 (≠ A227), Y238 (≠ M228)
- binding nicotinamide-adenine-dinucleotide: G12 (= G13), G14 (≠ S15), N15 (≠ R16), G16 (= G17), I17 (= I18), D36 (≠ Y37), I37 (≠ A38), W41 (≠ D42), D62 (= D59), T63 (≠ S60), N89 (= N82), A90 (= A83), G91 (= G84), I140 (= I130), Y155 (= Y146), K159 (= K150), P185 (= P176), I188 (= I179), T190 (= T181)
4ureB Molecular genetic and crystal structural analysis of 1-(4- hydroxyphenyl)-ethanol dehydrogenase from aromatoleum aromaticum ebn1 (see paper)
35% identity, 98% coverage: 4:235/237 of query aligns to 3:245/248 of 4ureB
- active site: G16 (= G17), S142 (= S132), I152 (≠ M143), Y155 (= Y146), K159 (= K150)
- binding 3-pyridinium-1-ylpropane-1-sulfonate: N15 (≠ R16), G16 (= G17), I17 (= I18), N89 (= N82), G91 (= G84), Y155 (= Y146), P185 (= P176), A186 (≠ G177)
Query Sequence
>18274 FitnessBrowser__Keio:18274
MGAFTGKTVLILGGSRGIGAAIVRRFVTDGANVRFTYAGSKDAAKRLAQETGATAVFTDS
ADRDAVIDVVRKSGALDILVVNAGIGVFGEALELNADDIDRLFKINIHAPYHASVEAARQ
MPEGGRILIIGSVNGDRMPVAGMAAYAASKSALQGMARGLARDFGPRGITINVVQPGPID
TDANPANGPMRDMLHSLMAIKRHGQPEEVAGMVAWLAGPEASFVTGAMHTIDGAFGA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory