SitesBLAST – Find functional sites

 

SitesBLAST

Comparing 18346 FitnessBrowser__Keio:18346 to proteins with known functional sites using BLASTp with E ≤ 0.001.

Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures

Found 4 hits to proteins with known functional sites (download)

4eacC Crystal structure of mannonate dehydratase from escherichia coli strain k12 (see paper)
100% identity, 100% coverage: 1:394/394 of query aligns to 3:396/396 of 4eacC

query
sites
4eacC
M
 
M
E
 
E
Q
 
Q
T
 
T
W
 
W
R
 
R
W
 
W
Y
 
Y
G
 
G
P
 
P
N
 
N
D
 
D
P
 
P
V
 
V
S
 
S
L
 
L
A
 
A
D
 
D
V
 
V
R
 
R
Q
 
Q
A
 
A
G
 
G
A
 
A
T
 
T
G
 
G
V
 
V
V
 
V
T
 
T
A
 
A
L
 
L
H
 
H
H
 
H
I
 
I
P
 
P
N
 
N
G
 
G
E
 
E
V
 
V
W
 
W
S
 
S
V
 
V
E
 
E
E
 
E
I
 
I
L
 
L
K
 
K
R
 
R
K
 
K
A
 
A
I
 
I
I
 
I
E
 
E
D
 
D
A
 
A
G
 
G
L
 
L
V
 
V
W
 
W
S
 
S
V
 
V
V
 
V
E
 
E
S
 
S
V
 
V
P
 
P
I
 
I
H
 
H
E
 
E
D
 
D
I
 
I
K
 
K
T
 
T
H
 
H
T
 
T
G
 
G
N
 
N
Y
 
Y
E
 
E
Q
 
Q
W
 
W
I
 
I
A
 
A
N
 
N
Y
 
Y
Q
 
Q
Q
 
Q
T
 
T
L
 
L
R
 
R
N
 
N
L
 
L
A
 
A
Q
 
Q
C
 
C
G
 
G
I
 
I
R
 
R
T
 
T
V
 
V
C
 
C
Y
 
Y
N
 
N
F
 
F
M
 
M
P
 
P
V
 
V
L
 
L
D
 
D
W
 
W
T
 
T
R
 
R
T
 
T
D
 
D
L
 
L
E
 
E
Y
 
Y
V
 
V
L
 
L
P
 
P
D
 
D
G
 
G
S
 
S
K
 
K
A
 
A
L
 
L
R
 
R
F
 
F
D
 
D
Q
 
Q
I
 
I
E
 
E
F
 
F
A
 
A
A
 
A
F
 
F
E
 
E
M
 
M
H
 
H
I
 
I
L
 
L
K
 
K
R
 
R
P
 
P
G
 
G
A
 
A
E
 
E
A
 
A
D
 
D
Y
 
Y
T
 
T
E
 
E
E
 
E
E
 
E
I
 
I
A
 
A
Q
 
Q
A
 
A
A
 
A
E
 
E
R
 
R
F
 
F
A
 
A
T
 
T
M
 
M
S
 
S
D
 
D
E
 
E
D
 
D
K
 
K
A
 
A
R
 
R
L
 
L
T
 
T
R
 
R
N
 
N
I
 
I
I
 
I
A
 
A
G
 
G
L
 
L
P
 
P
G
 
G
A
 
A
E
 
E
E
 
E
G
 
G
Y
 
Y
T
 
T
L
 
L
D
 
D
Q
 
Q
F
 
F
R
 
R
K
 
K
H
 
H
L
 
L
E
 
E
L
 
L
Y
 
Y
K
 
K
D
 
D
I
 
I
D
 
D
K
 
K
A
 
A
K
 
K
L
 
L
R
 
R
E
 
E
N
 
N
F
 
F
A
 
A
V
 
V
F
 
F
L
 
L
K
 
K
A
 
A
I
 
I
I
 
I
P
 
P
V
 
V
A
 
A
E
 
E
E
 
E
V
 
V
G
 
G
V
 
V
R
 
R
M
 
M
A
 
A
V
 
V
H
|
H
P
 
P
D
 
D
D
 
D
P
 
P
P
 
P
R
 
R
P
 
P
I
 
I
L
 
L
G
 
G
L
 
L
P
 
P
R
 
R
I
 
I
V
 
V
S
 
S
T
 
T
I
 
I
E
 
E
D
 
D
M
 
M
Q
 
Q
W
 
W
M
 
M
V
 
V
D
 
D
T
 
T
V
 
V
N
 
N
S
 
S
M
 
M
A
 
A
N
 
N
G
 
G
F
 
F
T
 
T
M
 
M
C
|
C
T
 
T
G
 
G
S
 
S
Y
 
Y
G
 
G
V
 
V
R
 
R
A
 
A
D
 
D
N
 
N
D
 
D
L
 
L
V
 
V
D
 
D
M
 
M
I
 
I
K
 
K
Q
 
Q
F
 
F
G
 
G
P
 
P
R
 
R
I
 
I
Y
 
Y
F
 
F
T
 
T
H
|
H
L
 
L
R
 
R
S
 
S
T
 
T
M
 
M
R
 
R
E
 
E
D
 
D
N
 
N
P
 
P
K
 
K
T
 
T
F
 
F
H
 
H
E
 
E
A
 
A
A
 
A
H
 
H
L
 
L
N
 
N
G
 
G
D
 
D
V
 
V
D
 
D
M
 
M
Y
 
Y
E
 
E
V
 
V
V
 
V
K
 
K
A
 
A
I
 
I
V
 
V
E
 
E
E
 
E
E
 
E
H
 
H
R
 
R
R
 
R
K
 
K
A
 
A
E
 
E
G
 
G
K
 
K
E
 
E
D
 
D
L
 
L
I
 
I
P
 
P
M
 
M
R
 
R
P
 
P
D
|
D
H
|
H
G
 
G
H
 
H
Q
 
Q
M
 
M
L
 
L
D
 
D
D
 
D
L
 
L
K
 
K
K
 
K
K
 
K
T
 
T
N
 
N
P
 
P
G
 
G
Y
|
Y
S
 
S
A
 
A
I
 
I
G
 
G
R
 
R
L
 
L
K
 
K
G
 
G
L
 
L
A
 
A
E
 
E
V
 
V
R
 
R
G
 
G
V
 
V
E
 
E
L
 
L
A
 
A
I
 
I
Q
 
Q
R
 
R
A
 
A
F
 
F
F
 
F
S
 
S
R
 
R

4eayA Crystal structures of mannonate dehydratase from escherichia coli strain k12 complexed with d-mannonate (see paper)
100% identity, 100% coverage: 1:393/394 of query aligns to 3:395/395 of 4eayA

query
sites
4eayA
M
 
M
E
 
E
Q
 
Q
T
 
T
W
 
W
R
|
R
W
 
W
Y
 
Y
G
 
G
P
 
P
N
 
N
D
 
D
P
 
P
V
 
V
S
 
S
L
 
L
A
 
A
D
 
D
V
 
V
R
 
R
Q
 
Q
A
 
A
G
 
G
A
 
A
T
 
T
G
 
G
V
 
V
V
 
V
T
 
T
A
 
A
L
 
L
H
 
H
H
 
H
I
 
I
P
 
P
N
 
N
G
 
G
E
 
E
V
 
V
W
 
W
S
 
S
V
 
V
E
 
E
E
 
E
I
 
I
L
 
L
K
 
K
R
 
R
K
 
K
A
 
A
I
 
I
I
 
I
E
 
E
D
 
D
A
 
A
G
 
G
L
 
L
V
 
V
W
 
W
S
 
S
V
 
V
V
 
V
E
|
E
S
 
S
V
 
V
P
 
P
I
 
I
H
 
H
E
 
E
D
 
D
I
 
I
K
 
K
T
 
T
H
 
H
T
 
T
G
 
G
N
 
N
Y
 
Y
E
 
E
Q
 
Q
W
 
W
I
 
I
A
 
A
N
 
N
Y
 
Y
Q
 
Q
Q
 
Q
T
 
T
L
 
L
R
 
R
N
 
N
L
 
L
A
 
A
Q
 
Q
C
 
C
G
 
G
I
 
I
R
 
R
T
 
T
V
 
V
C
 
C
Y
 
Y
N
 
N
F
 
F
M
 
M
P
 
P
V
 
V
L
 
L
D
|
D
W
|
W
T
 
T
R
 
R
T
 
T
D
 
D
L
 
L
E
 
E
Y
 
Y
V
 
V
L
 
L
P
 
P
D
 
D
G
 
G
S
 
S
K
 
K
A
 
A
L
 
L
R
 
R
F
 
F
D
 
D
Q
 
Q
I
 
I
E
 
E
F
 
F
A
 
A
A
 
A
F
 
F
E
 
E
M
 
M
H
 
H
I
 
I
L
 
L
K
 
K
R
 
R
P
 
P
G
 
G
A
 
A
E
 
E
A
 
A
D
 
D
Y
 
Y
T
 
T
E
 
E
E
 
E
E
 
E
I
 
I
A
 
A
Q
 
Q
A
 
A
A
 
A
E
 
E
R
 
R
F
 
F
A
 
A
T
 
T
M
 
M
S
 
S
D
 
D
E
 
E
D
 
D
K
 
K
A
 
A
R
 
R
L
 
L
T
 
T
R
 
R
N
 
N
I
 
I
I
 
I
A
 
A
G
 
G
L
 
L
P
 
P
G
 
G
A
 
A
E
 
E
E
 
E
G
 
G
Y
 
Y
T
 
T
L
 
L
D
 
D
Q
 
Q
F
 
F
R
 
R
K
 
K
H
 
H
L
 
L
E
 
E
L
 
L
Y
 
Y
K
 
K
D
 
D
I
 
I
D
 
D
K
 
K
A
 
A
K
 
K
L
 
L
R
 
R
E
 
E
N
 
N
F
 
F
A
 
A
V
 
V
F
 
F
L
 
L
K
 
K
A
 
A
I
 
I
I
 
I
P
 
P
V
 
V
A
 
A
E
 
E
E
 
E
V
 
V
G
 
G
V
 
V
R
 
R
M
 
M
A
 
A
V
 
V
H
|
H
P
 
P
D
 
D
D
|
D
P
 
P
P
 
P
R
 
R
P
 
P
I
 
I
L
 
L
G
 
G
L
 
L
P
 
P
R
 
R
I
 
I
V
 
V
S
 
S
T
 
T
I
 
I
E
 
E
D
 
D
M
 
M
Q
 
Q
W
 
W
M
 
M
V
 
V
D
 
D
T
 
T
V
 
V
N
 
N
S
 
S
M
 
M
A
 
A
N
 
N
G
 
G
F
 
F
T
 
T
M
 
M
C
|
C
T
 
T
G
 
G
S
 
S
Y
 
Y
G
 
G
V
 
V
R
 
R
A
 
A
D
 
D
N
 
N
D
 
D
L
 
L
V
 
V
D
 
D
M
 
M
I
 
I
K
 
K
Q
 
Q
F
 
F
G
 
G
P
 
P
R
 
R
I
 
I
Y
 
Y
F
 
F
T
 
T
H
|
H
L
 
L
R
|
R
S
 
S
T
 
T
M
 
M
R
 
R
E
 
E
D
 
D
N
 
N
P
 
P
K
 
K
T
 
T
F
 
F
H
 
H
E
 
E
A
 
A
A
 
A
H
 
H
L
 
L
N
 
N
G
 
G
D
 
D
V
 
V
D
 
D
M
 
M
Y
 
Y
E
 
E
V
 
V
V
 
V
K
 
K
A
 
A
I
 
I
V
 
V
E
 
E
E
 
E
E
 
E
H
 
H
R
 
R
R
 
R
K
 
K
A
 
A
E
 
E
G
 
G
K
 
K
E
 
E
D
 
D
L
 
L
I
 
I
P
 
P
M
 
M
R
 
R
P
 
P
D
|
D
H
|
H
G
 
G
H
 
H
Q
 
Q
M
 
M
L
 
L
D
 
D
D
 
D
L
 
L
K
 
K
K
 
K
K
 
K
T
 
T
N
 
N
P
 
P
G
 
G
Y
|
Y
S
 
S
A
 
A
I
 
I
G
 
G
R
 
R
L
 
L
K
 
K
G
 
G
L
 
L
A
 
A
E
 
E
V
 
V
R
 
R
G
 
G
V
 
V
E
 
E
L
 
L
A
 
A
I
 
I
Q
 
Q
R
 
R
A
 
A
F
 
F
F
 
F
S
 
S

3dbnA Crystal structure of the streptoccocus suis serotype2 d- mannonate dehydratase in complex with its substrate (see paper)
37% identity, 99% coverage: 1:390/394 of query aligns to 3:335/349 of 3dbnA

query
sites
3dbnA
M
 
M
E
 
K
Q
 
M
T
 
S
W
 
F
R
|
R
W
 
W
Y
 
Y
G
 
G
P
 
K
N
 
K
D
 
D
P
 
P
V
 
V
S
 
T
L
 
L
A
 
E
D
 
E
V
 
I
R
 
K
Q
 
A
-
 
I
A
 
P
G
 
G
A
 
M
T
 
Q
G
 
G
V
 
I
V
 
V
T
 
T
A
 
A
L
 
V
H
 
Y
H
 
D
I
 
V
P
 
P
N
 
V
G
 
G
E
 
Q
V
 
A
W
 
W
S
 
P
V
 
L
E
 
E
E
 
N
I
 
I
L
 
L
K
 
E
R
 
L
K
 
K
A
 
K
I
 
M
I
 
V
E
 
E
D
 
E
A
 
A
G
 
G
L
 
L
V
 
E
W
 
I
S
 
T
V
 
V
V
 
I
E
 
E
S
 
S
V
 
I
P
 
P
I
 
V
H
 
H
E
 
E
D
 
D
I
 
I
K
 
K
T
 
Q
H
 
G
T
 
K
G
 
P
N
 
N
Y
 
R
E
 
D
Q
 
A
W
 
L
I
 
I
A
 
E
N
 
N
Y
 
Y
Q
 
K
Q
 
T
T
 
S
L
 
I
R
 
R
N
 
N
L
 
V
A
 
G
Q
 
A
C
 
A
G
 
G
I
 
I
R
 
P
T
 
V
V
 
V
C
 
C
Y
 
Y
N
 
N
F
 
F
M
 
M
P
 
P
V
 
V
L
 
F
D
 
D
W
|
W
T
 
T
R
 
R
T
 
S
D
 
D
L
 
L
E
 
H
Y
 
H
V
 
P
L
 
L
P
 
P
D
 
D
G
 
G
S
 
S
K
 
T
A
 
S
L
 
L
R
 
A
F
 
F
D
 
-
Q
 
-
I
 
-
E
 
-
F
 
-
A
 
-
A
 
-
F
 
-
E
 
-
M
 
-
H
 
-
I
 
-
L
 
L
K
 
K
R
 
S
P
 
D
G
 
L
A
 
A
E
 
G
A
 
V
D
 
D
Y
 
P
T
 
S
E
 
K
E
 
E
E
 
E
I
 
M
A
 
K
Q
 
A
A
 
I
A
 
I
E
 
E
R
 
N
F
 
Y
-
 
R
A
 
Q
T
 
N
M
 
I
S
 
S
D
 
E
E
 
E
D
 
D
K
 
-
A
 
-
R
 
-
L
 
-
T
 
-
R
 
-
N
 
-
I
 
-
I
 
-
A
 
-
G
 
-
L
 
-
P
 
-
G
 
-
A
 
-
E
 
-
E
 
-
G
 
-
Y
 
-
T
 
-
L
 
-
D
 
-
Q
 
-
F
 
-
R
 
-
K
 
-
H
 
-
L
 
-
E
 
-
L
 
-
Y
 
-
K
 
-
D
 
-
I
 
-
D
 
-
K
 
-
A
 
-
K
 
-
L
 
L
R
 
W
E
 
A
N
 
N
F
 
L
A
 
E
V
 
Y
F
 
F
L
 
I
K
 
K
A
 
A
I
 
I
I
 
L
P
 
P
V
 
T
A
 
A
E
 
E
E
 
E
V
 
A
G
 
G
V
 
V
R
 
K
M
 
M
A
 
A
V
 
I
H
|
H
P
 
P
D
 
D
D
 
D
P
 
P
P
 
P
R
 
Y
P
 
G
I
 
I
L
 
F
G
 
G
L
 
L
P
 
P
R
 
R
I
 
I
V
 
I
S
 
T
T
 
G
I
 
Q
E
 
E
D
 
A
M
 
V
Q
 
E
W
 
R
M
 
F
V
 
L
D
 
N
T
 
L
V
 
Y
N
 
D
S
 
S
M
 
E
A
 
H
N
 
N
G
 
G
F
 
I
T
 
T
M
 
M
C
|
C
T
 
V
G
 
G
S
 
S
Y
 
Y
G
 
A
V
 
S
R
 
D
A
 
P
D
 
K
N
 
N
D
 
D
L
 
V
V
 
L
D
 
A
M
 
M
I
 
T
K
 
E
Q
 
Y
F
 
A
-
 
L
-
 
K
G
 
R
P
 
N
R
 
R
I
 
I
Y
 
N
F
 
F
T
 
M
H
|
H
L
 
T
R
 
R
S
 
N
T
 
V
M
 
T
R
 
A
E
 
-
D
 
-
N
 
G
P
 
A
K
 
W
T
 
G
F
 
F
H
 
Q
E
 
E
A
 
T
A
 
A
H
 
H
L
 
L
N
 
S
-
 
Q
-
 
A
G
 
G
D
 
D
V
 
I
D
 
D
M
 
M
Y
 
N
E
 
A
V
 
V
V
 
V
K
 
K
A
 
L
I
 
L
V
 
V
E
 
D
E
 
Y
E
 
D
H
 
W
R
 
Q
R
 
G
K
 
S
A
 
-
E
 
-
G
 
-
K
 
-
E
 
-
D
 
-
L
 
-
I
 
-
P
 
-
M
 
L
R
 
R
P
 
P
D
|
D
H
|
H
G
 
G
H
 
R
Q
 
R
M
 
I
L
 
W
D
 
G
D
 
D
L
 
Q
K
 
T
K
 
K
K
 
-
T
 
-
N
 
T
P
|
P
G
 
G
Y
|
Y
S
 
G
A
 
L
I
 
Y
G
 
D
R
 
R
L
 
A
K
 
L
G
 
G
L
 
A
A
 
T
E
 
Y
V
 
F
R
 
N
G
 
G
V
 
L
E
 
Y
L
 
E
A
 
A
I
 
N
Q
 
M
R
 
R
A
 
A

3bdkA Crystal structure of streptococcus suis mannonate dehydratase complexed with substrate analogue
37% identity, 99% coverage: 1:390/394 of query aligns to 3:335/349 of 3bdkA

query
sites
3bdkA
M
 
M
E
 
K
Q
 
M
T
 
S
W
 
F
R
|
R
W
 
W
Y
 
Y
G
 
G
P
 
K
N
 
K
D
 
D
P
 
P
V
 
V
S
 
T
L
 
L
A
 
E
D
 
E
V
 
I
R
 
K
Q
 
A
-
 
I
A
 
P
G
 
G
A
 
M
T
 
Q
G
 
G
V
 
I
V
 
V
T
 
T
A
 
A
L
 
V
H
 
Y
H
 
D
I
 
V
P
 
P
N
 
V
G
 
G
E
 
Q
V
 
A
W
 
W
S
 
P
V
 
L
E
 
E
E
 
N
I
 
I
L
 
L
K
 
E
R
 
L
K
 
K
A
 
K
I
 
M
I
 
V
E
 
E
D
 
E
A
 
A
G
 
G
L
 
L
V
 
E
W
 
I
S
 
T
V
 
V
V
 
I
E
 
E
S
 
S
V
 
I
P
 
P
I
 
V
H
 
H
E
 
E
D
 
D
I
 
I
K
 
K
T
 
Q
H
 
G
T
 
K
G
 
P
N
 
N
Y
 
R
E
 
D
Q
 
A
W
 
L
I
 
I
A
 
E
N
 
N
Y
 
Y
Q
 
K
Q
 
T
T
 
S
L
 
I
R
 
R
N
 
N
L
 
V
A
 
G
Q
 
A
C
 
A
G
 
G
I
 
I
R
 
P
T
 
V
V
 
V
C
 
C
Y
 
Y
N
 
N
F
 
F
M
 
M
P
 
P
V
 
V
L
 
F
D
|
D
W
|
W
T
 
T
R
 
R
T
 
S
D
 
D
L
 
L
E
 
H
Y
 
H
V
 
P
L
 
L
P
 
P
D
 
D
G
 
G
S
 
S
K
 
T
A
 
S
L
 
L
R
 
A
F
 
F
D
 
-
Q
 
-
I
 
-
E
 
-
F
 
-
A
 
-
A
 
-
F
 
-
E
 
-
M
 
-
H
 
-
I
 
-
L
 
L
K
 
K
R
 
S
P
 
D
G
 
L
A
 
A
E
 
G
A
 
V
D
 
D
Y
 
P
T
 
S
E
 
K
E
 
E
E
 
E
I
 
M
A
 
K
Q
 
A
A
 
I
A
 
I
E
 
E
R
 
N
F
 
Y
-
 
R
A
 
Q
T
 
N
M
 
I
S
 
S
D
 
E
E
 
E
D
 
D
K
 
-
A
 
-
R
 
-
L
 
-
T
 
-
R
 
-
N
 
-
I
 
-
I
 
-
A
 
-
G
 
-
L
 
-
P
 
-
G
 
-
A
 
-
E
 
-
E
 
-
G
 
-
Y
 
-
T
 
-
L
 
-
D
 
-
Q
 
-
F
 
-
R
 
-
K
 
-
H
 
-
L
 
-
E
 
-
L
 
-
Y
 
-
K
 
-
D
 
-
I
 
-
D
 
-
K
 
-
A
 
-
K
 
-
L
 
L
R
 
W
E
 
A
N
 
N
F
 
L
A
 
E
V
 
Y
F
 
F
L
 
I
K
 
K
A
 
A
I
 
I
I
 
L
P
 
P
V
 
T
A
 
A
E
 
E
E
 
E
V
 
A
G
 
G
V
 
V
R
 
K
M
 
M
A
 
A
V
 
I
H
|
H
P
 
P
D
 
D
D
 
D
P
 
P
P
 
P
R
 
Y
P
 
G
I
 
I
L
 
F
G
 
G
L
 
L
P
 
P
R
 
R
I
 
I
V
 
I
S
 
T
T
 
G
I
 
Q
E
 
E
D
 
A
M
 
V
Q
 
E
W
 
R
M
 
F
V
 
L
D
 
N
T
 
L
V
 
Y
N
 
D
S
 
S
M
 
E
A
 
H
N
 
N
G
 
G
F
 
I
T
 
T
M
 
M
C
|
C
T
 
V
G
 
G
S
 
S
Y
 
Y
G
 
A
V
 
S
R
 
D
A
 
P
D
 
K
N
 
N
D
 
D
L
 
V
V
 
L
D
 
A
M
 
M
I
 
T
K
 
E
Q
 
Y
F
 
A
-
 
L
-
 
K
G
 
R
P
 
N
R
 
R
I
 
I
Y
 
N
F
 
F
T
 
M
H
|
H
L
 
T
R
 
R
S
 
N
T
 
V
M
 
T
R
 
A
E
 
-
D
 
-
N
 
G
P
 
A
K
 
W
T
 
G
F
 
F
H
 
Q
E
 
E
A
 
T
A
 
A
H
 
H
L
 
L
N
 
S
-
 
Q
-
 
A
G
 
G
D
 
D
V
 
I
D
 
D
M
 
M
Y
 
N
E
 
A
V
 
V
V
 
V
K
 
K
A
 
L
I
 
L
V
 
V
E
 
D
E
 
Y
E
 
D
H
 
W
R
 
Q
R
 
G
K
 
S
A
 
-
E
 
-
G
 
-
K
 
-
E
 
-
D
 
-
L
 
-
I
 
-
P
 
-
M
 
L
R
 
R
P
 
P
D
|
D
H
|
H
G
 
G
H
 
R
Q
 
R
M
 
I
L
 
W
D
 
G
D
 
D
L
 
Q
K
 
T
K
 
K
K
 
-
T
 
-
N
 
T
P
 
P
G
 
G
Y
|
Y
S
 
G
A
 
L
I
 
Y
G
 
D
R
 
R
L
 
A
K
 
L
G
 
G
L
 
A
A
 
T
E
 
Y
V
 
F
R
 
N
G
 
G
V
 
L
E
 
Y
L
 
E
A
 
A
I
 
N
Q
 
M
R
 
R
A
 
A

Query Sequence

>18346 FitnessBrowser__Keio:18346
MEQTWRWYGPNDPVSLADVRQAGATGVVTALHHIPNGEVWSVEEILKRKAIIEDAGLVWS
VVESVPIHEDIKTHTGNYEQWIANYQQTLRNLAQCGIRTVCYNFMPVLDWTRTDLEYVLP
DGSKALRFDQIEFAAFEMHILKRPGAEADYTEEEIAQAAERFATMSDEDKARLTRNIIAG
LPGAEEGYTLDQFRKHLELYKDIDKAKLRENFAVFLKAIIPVAEEVGVRMAVHPDDPPRP
ILGLPRIVSTIEDMQWMVDTVNSMANGFTMCTGSYGVRADNDLVDMIKQFGPRIYFTHLR
STMREDNPKTFHEAAHLNGDVDMYEVVKAIVEEEHRRKAEGKEDLIPMRPDHGHQMLDDL
KKKTNPGYSAIGRLKGLAEVRGVELAIQRAFFSR

Or try a new SitesBLAST search

SitesBLAST's Database

SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.

by Morgan Price, Arkin group
Lawrence Berkeley National Laboratory