SitesBLAST
Comparing 18380 FitnessBrowser__Keio:18380 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 18 hits to proteins with known functional sites (download)
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
29% identity, 93% coverage: 21:443/453 of query aligns to 2:423/430 of P0AA76
- Y29 (= Y55) binding
- D31 (= D57) mutation to N: Loss of galactonate transport activity.
- R32 (= R58) binding
- Y64 (= Y90) binding
- E118 (= E144) mutation to Q: Loss of galactonate transport activity.
- W358 (= W377) binding
6e9nA E. Coli d-galactonate:proton symporter in the inward open form (see paper)
30% identity, 90% coverage: 38:443/453 of query aligns to 1:404/409 of 6e9nA
6e9oA E. Coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form (see paper)
29% identity, 90% coverage: 38:443/453 of query aligns to 4:388/393 of 6e9oA
Q9JI12 Vesicular glutamate transporter 2; VGluT2; Differentiation-associated BNPI; Differentiation-associated Na(+)-dependent inorganic phosphate cotransporter; Solute carrier family 17 member 6 from Rattus norvegicus (Rat) (see 2 papers)
21% identity, 89% coverage: 51:452/453 of query aligns to 94:510/582 of Q9JI12
- H128 (≠ L83) mutation to A: Greatly lowers L-glutamate transport.
- R184 (= R137) mutation R->A,E,K: Greatly lowers L-glutamate transport.
- E191 (= E144) mutation to A: Greatly lowers L-glutamate transport.; mutation E->D,Q: Lowers L-glutamate transport.
- R322 (≠ I269) mutation to A: Loss of L-glutamate release. Abolishes the chloride ion conductance.
Sites not aligning to the query:
- 88 R→A: Impairs synaptic transmission. Abolishes the chloride ion conductance.
Q9NRA2 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Membrane glycoprotein HP59; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Homo sapiens (Human) (see 8 papers)
21% identity, 83% coverage: 75:449/453 of query aligns to 104:484/495 of Q9NRA2
- K136 (≠ R107) to E: in SD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transporter activity, but retains appreciable H(+)-coupled sialic acid transporter activity; dbSNP:rs80338795
- H183 (≠ V152) to R: in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity; dbSNP:rs119491109
- LL 198:199 (≠ PM 167:168) mutation to AA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- I----L 266:267 (≠ LNAGSV 233:238) mutation to LA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- SSLRN 268:272 (≠ NARRD 239:243) natural variant: Missing (in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity)
- G328 (= G296) to E: in ISSD; some patients may manifest a milder phenotype consistent with Salla disease; markedly decreases H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs386833996
- P334 (= P302) to R: in ISSD; does not affect intracellular localization, targeted to lysosomes; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs119491110
- G371 (= G338) to V: in ISSD; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs777862172
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane.; LL→GG: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R → C: in SD; frequent variant in Finland; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transport activity, but retains appreciable H(+)-coupled sialic acid and nitrate transporter activity; dbSNP:rs80338794
7t3nA R184q/e191q mutant of rat vesicular glutamate transporter 2 (vglut2)
20% identity, 89% coverage: 51:452/453 of query aligns to 36:452/452 of 7t3nA
Sites not aligning to the query:
Q8BN82 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Mus musculus (Mouse) (see paper)
24% identity, 60% coverage: 75:345/453 of query aligns to 104:378/495 of Q8BN82
- H183 (≠ V152) mutation to R: Abolishes sialic acid transporter activity. Does not affect L-aspartate and L-glutamate transporter activity.
Sites not aligning to the query:
- 39 R→C: Completely abolishes L-aspartate and L-glutamate transporter activity. Retains appreciable H(+)-coupled sialic acid transporter activity.
Q5Q0U0 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 (Anion/sugar transporter), member 5; Vesicular excitatory amino acid transporter; VEAT from Rattus norvegicus (Rat) (see 2 papers)
24% identity, 60% coverage: 75:345/453 of query aligns to 104:378/495 of Q5Q0U0
- K136 (≠ R107) mutation to E: Markedly decreases H(+)-coupled sialic acid transporter activity.
- R168 (= R137) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- E171 (≠ M140) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-175.
- G172 (= G141) mutation to C: Decreases protein levels and alters subcellular localization.
- E175 (= E144) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-171.
- G176 (≠ A145) mutation to C: Decreases protein levels and alters subcellular localization.
- F179 (≠ N148) mutation to C: Decreases the affinity and transport rate for D-glucuronate. Does not affect H(+)-coupled sialic acid transporter activity.
- P180 (= P149) mutation to C: Decreases protein levels and alters subcellular localization.
- H183 (≠ V152) mutation to R: Abolishes H(+)-coupled sialic acid transporter activity.
- W186 (≠ I155) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- SSLKN 268:272 (≠ GSVNA 236:240) mutation Missing: Abolishes H(+)-coupled sialic acid transporter activity.
- P334 (= P302) mutation to R: Abolishes H(+)-coupled sialic acid transporter activity.
- G371 (= G338) mutation to V: Remains in the endoplasmic reticulum.
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R→C: Markedly decreases H(+)-coupled sialic acid transporter activity.
Q9Y2C5 Probable small intestine urate exporter; Solute carrier family 17 member 4 from Homo sapiens (Human) (see 2 papers)
20% identity, 81% coverage: 87:453/453 of query aligns to 116:491/497 of Q9Y2C5
- A372 (≠ I336) to T: in dbSNP:rs11754288
Sites not aligning to the query:
- 66 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: Loss of glycosylation and significant reduction in the transport of thyroid hormones T3 and T4; when associated with A-75 and A-90.
- 75 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: Loss of glycosylation and significant reduction in the transport of thyroid hormones T3 and T4; when associated with A-66 and A-90.
- 90 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: Loss of glycosylation and significant reduction in the transport of thyroid hormones T3 and T4; when associated with A-75 and A-90.
Q9GQQ0 Protein spinster; Protein benchwarmer; Protein diphthong from Drosophila melanogaster (Fruit fly) (see paper)
23% identity, 71% coverage: 24:343/453 of query aligns to 96:411/605 of Q9GQQ0
- E217 (= E144) mutation to K: In bnch(N); leads to storage in yolk spheres during oogenesis and results in widespread accumulation of enlarged lysosomal and late endosomal inclusions.
Q8IVW8 Sphingosine-1-phosphate transporter SPNS2; Protein spinster homolog 2 from Homo sapiens (Human) (see 2 papers)
25% identity, 86% coverage: 26:416/453 of query aligns to 87:484/549 of Q8IVW8
- R200 (= R137) mutation to S: Loss of function; does not rescue the cardia bifida phenotype in the morpholino knockdown in zebrafish.
- S319 (≠ M263) natural variant: Missing (in DFNB115; uncertain significance; dbSNP:rs749994718)
7yubR S1p-bound human spns2 (see paper)
25% identity, 85% coverage: 32:416/453 of query aligns to 1:372/429 of 7yubR
8g92A Structure of inhibitor 16d-bound spns2 (see paper)
26% identity, 84% coverage: 37:416/453 of query aligns to 2:360/415 of 8g92A
7yudR Fty720p-bound human spns2 (see paper)
24% identity, 83% coverage: 43:416/453 of query aligns to 5:360/417 of 7yudR
8jhqA Cryo-em structure of human s1p transporter spns2 bound with s1p (see paper)
25% identity, 84% coverage: 36:416/453 of query aligns to 3:389/446 of 8jhqA
Q03567 Uncharacterized transporter slc-17.2 from Caenorhabditis elegans (see paper)
18% identity, 91% coverage: 27:439/453 of query aligns to 2:457/493 of Q03567
- N69 (= N65) modified: carbohydrate, N-linked (GlcNAc...) asparagine
A2SWM2 Sphingosine-1-phosphate transporter SPNS2; Protein spinster homolog 2; Protein two of hearts from Danio rerio (Zebrafish) (Brachydanio rerio) (see paper)
29% identity, 31% coverage: 38:178/453 of query aligns to 52:194/504 of A2SWM2
- R153 (= R137) mutation to S: In ko157; displays cardia bifida (2 hearts).
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
23% identity, 38% coverage: 40:211/453 of query aligns to 20:191/452 of Q5EXK5
- D82 (= D102) mutation to A: Loss of activity.
Sites not aligning to the query:
- 311 V→W: Loss of activity.
- 314 D→A: Loss of activity.
Query Sequence
>18380 FitnessBrowser__Keio:18380
MEKENITIDPRSSFTPSSSADIPVPPDGLVQRSTRIKRIQTTAMLLLFFAAVINYLDRSS
LSVANLTIREELGLSATEIGALLSVFSLAYGIAQLPCGPLLDRKGPRLMLGLGMFFWSLF
QAMSGMVHNFTQFVLVRIGMGIGEAPMNPCGVKVINDWFNIKERGRPMGFFNAASTIGVA
VSPPILAAMMLVMGWRGMFITIGVLGIFLAIGWYMLYRNREHVELTAVEQAYLNAGSVNA
RRDPLSFAEWRSLFRNRTMWGMMLGFSGINYTAWLYLAWLPGYLQTAYNLDLKSTGLMAA
IPFLFGAAGMLVNGYVTDWLVKGGMAPIKSRKICIIAGMFCSAAFTLIVPQATTSMTAVL
LIGMALFCIHFAGTSCWGLIHVAVASRMTASVGSIQNFASFICASFAPIITGFIVDTTHS
FRLALIICGCVTAAGALAYIFLVRQPINDPRKD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory