SitesBLAST
Comparing 1936210 FitnessBrowser__Keio:1936210 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6u9dB Saccharomyces cerevisiae acetohydroxyacid synthase (see paper)
43% identity, 98% coverage: 4:566/574 of query aligns to 12:584/607 of 6u9dB
- active site: Y33 (= Y25), G35 (= G27), G36 (= G28), A37 (= A29), I38 (≠ V30), E59 (= E51), T82 (= T74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), M274 (= M260), V301 (≠ T287), V417 (= V395), G443 (= G421), M445 (= M423), D470 (= D448), N497 (= N475), E499 (≠ Y477), Q500 (≠ L478), M502 (= M480), V503 (= V481), W506 (= W484)
- binding methyl 2-[(4,6-dimethoxypyrimidin-2-yl)carbamoylsulfamoylmethyl]benzoate: G36 (= G28), V111 (= V103), P112 (≠ A104), F121 (= F113), K171 (= K163), D299 (= D285), R300 (= R286), M502 (= M480), W506 (= W484)
- binding flavin-adenine dinucleotide: R161 (= R153), A228 (≠ G215), G229 (= G216), N232 (≠ T219), T254 (≠ S240), L255 (= L241), Q256 (≠ M242), L272 (= L258), M274 (= M260), G294 (= G280), R296 (= R282), D298 (= D284), R300 (= R286), V301 (≠ T287), E327 (≠ D304), V328 (≠ I305), N332 (≠ S309), D346 (= D323), A347 (= A324), M422 (= M400), G440 (= G418), G441 (= G419)
- binding magnesium ion: D470 (= D448), N497 (= N475)
- binding thiamine diphosphate: E59 (= E51), P85 (= P77), V417 (= V395), G418 (= G396), Q419 (= Q397), H420 (= H398), G443 (= G421), M445 (= M423), A471 (≠ G449), S472 (= S450), N497 (= N475), E499 (≠ Y477), Q500 (≠ L478), G501 (= G479), M502 (= M480), V503 (= V481)
P07342 Acetolactate synthase catalytic subunit, mitochondrial; Acetohydroxy-acid synthase catalytic subunit; AHAS; ALS; EC 2.2.1.6 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
43% identity, 98% coverage: 4:566/574 of query aligns to 92:664/687 of P07342
- R241 (= R153) binding
- 355:376 (vs. 261:282, 55% identical) binding
- 407:426 (vs. 304:323, 35% identical) binding
1t9cA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, sulfometuron methyl (see paper)
43% identity, 98% coverage: 4:566/574 of query aligns to 8:573/596 of 1t9cA
- active site: Y29 (= Y25), G31 (= G27), G32 (= G28), A33 (= A29), I34 (≠ V30), E55 (= E51), T78 (= T74), F117 (= F113), Q118 (= Q114), E119 (= E115), K167 (= K163), R227 (≠ Q224), M263 (= M260), V290 (≠ T287), V406 (= V395), L431 (= L420), G432 (= G421), M434 (= M423), D459 (= D448), N486 (= N475), E488 (≠ Y477), Q489 (≠ L478), M491 (= M480), V492 (= V481), W495 (= W484), L517 (= L507), G522 (= G512), L523 (≠ H513), K556 (≠ G549)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (= G28), V107 (= V103), P108 (≠ A104), F117 (= F113), K167 (= K163), D288 (= D285), R289 (= R286), W495 (= W484)
- binding flavin-adenine dinucleotide: R157 (= R153), G216 (= G214), A217 (≠ G215), G218 (= G216), N221 (≠ T219), T243 (≠ S240), L244 (= L241), Q245 (≠ M242), L261 (= L258), M263 (= M260), H264 (= H261), G283 (= G280), A284 (≠ V281), R285 (= R282), D287 (= D284), R289 (= R286), V290 (≠ T287), E316 (≠ D304), V317 (≠ I305), N321 (≠ S309), G334 (= G322), D335 (= D323), A336 (= A324), M411 (= M400), G429 (= G418), G430 (= G419)
- binding magnesium ion: D459 (= D448), N486 (= N475), E488 (≠ Y477)
1n0hA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorimuron ethyl (see paper)
43% identity, 98% coverage: 4:566/574 of query aligns to 10:576/599 of 1n0hA
- active site: Y31 (= Y25), G33 (= G27), G34 (= G28), A35 (= A29), I36 (≠ V30), E57 (= E51), T80 (= T74), F119 (= F113), Q120 (= Q114), E121 (= E115), K169 (= K163), R230 (≠ Q224), M266 (= M260), V293 (≠ T287), V409 (= V395), L434 (= L420), G435 (= G421), M437 (= M423), D462 (= D448), N489 (= N475), E491 (≠ Y477), Q492 (≠ L478), M494 (= M480), V495 (= V481), W498 (= W484), L520 (= L507), G525 (= G512), L526 (≠ H513), K559 (≠ G549)
- binding 4-{[(4'-amino-2'-methylpyrimidin-5'-yl)methyl]amino}pent-3-enyl diphosphate: V409 (= V395), G410 (= G396), Q411 (= Q397), H412 (= H398), G435 (= G421), M437 (= M423), G461 (= G447), D462 (= D448), A463 (≠ G449), S464 (= S450), M467 (= M453), N489 (= N475), E491 (≠ Y477), Q492 (≠ L478), G493 (= G479), V495 (= V481)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: G34 (= G28), A35 (= A29), V109 (= V103), P110 (≠ A104), F119 (= F113), K169 (= K163), M266 (= M260), D291 (= D285), R292 (= R286), V495 (= V481), W498 (= W484)
- binding flavin-adenine dinucleotide: R159 (= R153), G219 (= G214), A220 (≠ G215), G221 (= G216), N224 (≠ T219), T246 (≠ S240), L247 (= L241), Q248 (≠ M242), L264 (= L258), G265 (= G259), M266 (= M260), H267 (= H261), G286 (= G280), A287 (≠ V281), R288 (= R282), D290 (= D284), R292 (= R286), V293 (≠ T287), E319 (≠ D304), V320 (≠ I305), N324 (≠ S309), G337 (= G322), D338 (= D323), A339 (= A324), M414 (= M400), G432 (= G418), G433 (= G419)
- binding magnesium ion: D462 (= D448), N489 (= N475), E491 (≠ Y477)
- binding thiamine diphosphate: Y31 (= Y25), E57 (= E51), P83 (= P77)
1t9dB Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
43% identity, 98% coverage: 4:566/574 of query aligns to 7:559/582 of 1t9dB
- active site: Y28 (= Y25), G30 (= G27), G31 (= G28), A32 (= A29), I33 (≠ V30), E54 (= E51), T77 (= T74), F116 (= F113), Q117 (= Q114), E118 (= E115), K166 (= K163), R213 (≠ Q224), M249 (= M260), V276 (≠ T287), V392 (= V395), L417 (= L420), G418 (= G421), M420 (= M423), D445 (= D448), N472 (= N475), E474 (≠ Y477), Q475 (≠ L478), M477 (= M480), V478 (= V481), W481 (= W484), L503 (= L507), G508 (= G512), L509 (≠ H513), K542 (≠ G549)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G31 (= G28), A32 (= A29), V106 (= V103), P107 (≠ A104), F116 (= F113), K166 (= K163), M249 (= M260), D274 (= D285), R275 (= R286), W481 (= W484)
- binding flavin-adenine dinucleotide: R156 (= R153), G202 (= G214), A203 (≠ G215), G204 (= G216), N207 (≠ T219), T229 (≠ S240), L230 (= L241), Q231 (≠ M242), L247 (= L258), M249 (= M260), H250 (= H261), G269 (= G280), A270 (≠ V281), R271 (= R282), D273 (= D284), R275 (= R286), V276 (≠ T287), E302 (≠ D304), V303 (≠ I305), N307 (≠ S309), G320 (= G322), D321 (= D323), A322 (= A324), Q396 (= Q399), M397 (= M400), G415 (= G418), G416 (= G419)
- binding magnesium ion: D445 (= D448), N472 (= N475), E474 (≠ Y477)
- binding 2,5-dimethyl-pyrimidin-4-ylamine: E54 (= E51), P80 (= P77), G418 (= G421), M420 (= M423), M450 (= M453)
1t9bA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
43% identity, 98% coverage: 4:566/574 of query aligns to 8:560/583 of 1t9bA
- active site: Y29 (= Y25), G31 (= G27), G32 (= G28), A33 (= A29), I34 (≠ V30), E55 (= E51), T78 (= T74), F117 (= F113), Q118 (= Q114), E119 (= E115), K167 (= K163), R214 (≠ Q224), M250 (= M260), V277 (≠ T287), V393 (= V395), L418 (= L420), G419 (= G421), M421 (= M423), D446 (= D448), N473 (= N475), E475 (≠ Y477), Q476 (≠ L478), M478 (= M480), V479 (= V481), W482 (= W484), L504 (= L507), G509 (= G512), L510 (≠ H513), K543 (≠ G549)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: V107 (= V103), P108 (≠ A104), F117 (= F113), D275 (= D285), R276 (= R286), M478 (= M480), W482 (= W484)
- binding flavin-adenine dinucleotide: R157 (= R153), G203 (= G214), A204 (≠ G215), G205 (= G216), N208 (≠ T219), T230 (≠ S240), L231 (= L241), Q232 (≠ M242), M247 (= M257), L248 (= L258), M250 (= M260), H251 (= H261), G270 (= G280), A271 (≠ V281), R272 (= R282), D274 (= D284), R276 (= R286), V277 (≠ T287), E303 (≠ D304), V304 (≠ I305), N308 (≠ S309), D322 (= D323), A323 (= A324), Q397 (= Q399), M398 (= M400), G416 (= G418), G417 (= G419)
- binding magnesium ion: D446 (= D448), N473 (= N475), E475 (≠ Y477)
5wkcA Saccharomyces cerevisiae acetohydroxyacid synthase in complex with the herbicide penoxsulam (see paper)
43% identity, 98% coverage: 4:566/574 of query aligns to 8:568/591 of 5wkcA
- active site: Y29 (= Y25), G31 (= G27), G32 (= G28), A33 (= A29), I34 (≠ V30), E55 (= E51), T78 (= T74), F117 (= F113), Q118 (= Q114), E119 (= E115), K167 (= K163), R222 (≠ Q224), M258 (= M260), V285 (≠ T287), V401 (= V395), L426 (= L420), G427 (= G421), M429 (= M423), D454 (= D448), N481 (= N475), E483 (≠ Y477), Q484 (≠ L478), M486 (= M480), V487 (= V481), W490 (= W484), L512 (= L507), G517 (= G512), L518 (≠ H513), K551 (≠ G549)
- binding 2-[3-[(4-azanyl-2-methyl-pyrimidin-5-yl)methyl]-2-[(1~{S})-1-(dioxidanyl)-1-oxidanyl-ethyl]-4-methyl-1,3-thiazol-5-yl]ethyl phosphono hydrogen phosphate: V401 (= V395), G402 (= G396), Q403 (= Q397), H404 (= H398), G427 (= G421), M429 (= M423), G453 (= G447), D454 (= D448), A455 (≠ G449), S456 (= S450), M459 (= M453), N481 (= N475), E483 (≠ Y477), Q484 (≠ L478), G485 (= G479), M486 (= M480), V487 (= V481)
- binding ethaneperoxoic acid: G32 (= G28), Q118 (= Q114)
- binding flavin-adenine dinucleotide: R157 (= R153), G211 (= G214), A212 (≠ G215), G213 (= G216), N216 (≠ T219), T238 (≠ S240), L239 (= L241), Q240 (≠ M242), L256 (= L258), M258 (= M260), G278 (= G280), A279 (≠ V281), R280 (= R282), R284 (= R286), V285 (≠ T287), E311 (≠ D304), V312 (≠ I305), N316 (≠ S309), D330 (= D323), A331 (= A324), M406 (= M400), G424 (= G418)
- binding magnesium ion: D454 (= D448), N481 (= N475), E483 (≠ Y477)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: G32 (= G28), A33 (= A29), V107 (= V103), F117 (= F113), K167 (= K163), M258 (= M260), R284 (= R286), M486 (= M480), W490 (= W484)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: P30 (= P26), E55 (= E51)
1t9dA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, metsulfuron methyl (see paper)
43% identity, 98% coverage: 4:566/574 of query aligns to 8:573/596 of 1t9dA
- active site: Y29 (= Y25), G31 (= G27), G32 (= G28), A33 (= A29), I34 (≠ V30), E55 (= E51), T78 (= T74), F117 (= F113), Q118 (= Q114), E119 (= E115), K167 (= K163), R227 (≠ Q224), M263 (= M260), V290 (≠ T287), V406 (= V395), L431 (= L420), G432 (= G421), M434 (= M423), D459 (= D448), N486 (= N475), E488 (≠ Y477), Q489 (≠ L478), M491 (= M480), V492 (= V481), W495 (= W484), L517 (= L507), G522 (= G512), L523 (≠ H513), K556 (≠ G549)
- binding methyl 2-[({[(4-methoxy-6-methyl-1,3,5-triazin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: G32 (= G28), A33 (= A29), V107 (= V103), P108 (≠ A104), F117 (= F113), K167 (= K163), M263 (= M260), D288 (= D285), R289 (= R286), W495 (= W484)
- binding flavin-adenine dinucleotide: R157 (= R153), G216 (= G214), A217 (≠ G215), G218 (= G216), N221 (≠ T219), T243 (≠ S240), L244 (= L241), Q245 (≠ M242), M260 (= M257), L261 (= L258), H264 (= H261), G283 (= G280), A284 (≠ V281), R285 (= R282), D287 (= D284), R289 (= R286), V290 (≠ T287), E316 (≠ D304), V317 (≠ I305), N321 (≠ S309), G334 (= G322), D335 (= D323), A336 (= A324), Q410 (= Q399), M411 (= M400), G429 (= G418), G430 (= G419)
- binding magnesium ion: D459 (= D448), N486 (= N475), E488 (≠ Y477)
- binding 2,5-dimethyl-pyrimidin-4-ylamine: E55 (= E51), P81 (= P77), Q118 (= Q114), G432 (= G421), M434 (= M423), M464 (= M453)
1t9bB Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, chlorsulfuron (see paper)
43% identity, 98% coverage: 4:566/574 of query aligns to 8:572/595 of 1t9bB
- active site: Y29 (= Y25), G31 (= G27), G32 (= G28), A33 (= A29), I34 (≠ V30), E55 (= E51), T78 (= T74), F117 (= F113), Q118 (= Q114), E119 (= E115), K167 (= K163), R226 (≠ Q224), M262 (= M260), V289 (≠ T287), V405 (= V395), L430 (= L420), G431 (= G421), M433 (= M423), D458 (= D448), N485 (= N475), E487 (≠ Y477), Q488 (≠ L478), M490 (= M480), V491 (= V481), W494 (= W484), L516 (= L507), G521 (= G512), L522 (≠ H513), K555 (≠ G549)
- binding 1-(2-chlorophenylsulfonyl)-3-(4-methoxy-6-methyl-l,3,5-triazin-2-yl)urea: V107 (= V103), P108 (≠ A104), D287 (= D285), R288 (= R286), M490 (= M480), W494 (= W484)
- binding flavin-adenine dinucleotide: R157 (= R153), G215 (= G214), A216 (≠ G215), G217 (= G216), N220 (≠ T219), T242 (≠ S240), L243 (= L241), Q244 (≠ M242), M259 (= M257), L260 (= L258), M262 (= M260), H263 (= H261), G282 (= G280), A283 (≠ V281), R284 (= R282), D286 (= D284), R288 (= R286), V289 (≠ T287), E315 (≠ D304), V316 (≠ I305), N320 (≠ S309), G333 (= G322), D334 (= D323), A335 (= A324), Q409 (= Q399), M410 (= M400), G428 (= G418), G429 (= G419)
- binding magnesium ion: D458 (= D448), N485 (= N475), E487 (≠ Y477)
1t9aA Crystal structure of yeast acetohydroxyacid synthase in complex with a sulfonylurea herbicide, tribenuron methyl (see paper)
43% identity, 98% coverage: 4:566/574 of query aligns to 9:574/597 of 1t9aA
- active site: Y30 (= Y25), G32 (= G27), G33 (= G28), A34 (= A29), I35 (≠ V30), E56 (= E51), T79 (= T74), F118 (= F113), Q119 (= Q114), E120 (= E115), K168 (= K163), R228 (≠ Q224), M264 (= M260), V291 (≠ T287), V407 (= V395), L432 (= L420), G433 (= G421), M435 (= M423), D460 (= D448), N487 (= N475), E489 (≠ Y477), Q490 (≠ L478), M492 (= M480), V493 (= V481), W496 (= W484), L518 (= L507), G523 (= G512), L524 (≠ H513), K557 (≠ G549)
- binding methyl 2-[4-methoxy-6-methyl-1,3,5-trazin-2-yl(methyl)carbamoylsulfamoyl]benzoate: G33 (= G28), V108 (= V103), P109 (≠ A104), F118 (= F113), K168 (= K163), M264 (= M260), D289 (= D285), R290 (= R286), M492 (= M480), V493 (= V481), W496 (= W484)
- binding flavin-adenine dinucleotide: R158 (= R153), G217 (= G214), A218 (≠ G215), G219 (= G216), N222 (≠ T219), T244 (≠ S240), L245 (= L241), Q246 (≠ M242), L262 (= L258), M264 (= M260), H265 (= H261), G284 (= G280), A285 (≠ V281), R286 (= R282), D288 (= D284), R290 (= R286), V291 (≠ T287), E317 (≠ D304), V318 (≠ I305), N322 (≠ S309), G335 (= G322), D336 (= D323), A337 (= A324), Q411 (= Q399), M412 (= M400), G430 (= G418), G431 (= G419)
- binding magnesium ion: D460 (= D448), N487 (= N475), E489 (≠ Y477)
- binding propyl trihydrogen diphosphate: V407 (= V395), G408 (= G396), Q409 (= Q397), H410 (= H398), M435 (= M423), G459 (= G447), D460 (= D448), A461 (≠ G449), S462 (= S450), N487 (= N475), E489 (≠ Y477), Q490 (≠ L478), G491 (= G479), M492 (= M480)
- binding 5-{[ethyl(methyl)amino]methyl}-2-methyl-5,6-dihydropyrimidin-4-amine: G433 (= G421), M435 (= M423), M465 (= M453)
P09342 Acetolactate synthase 1, chloroplastic; ALS I; Acetohydroxy-acid synthase I; Acetolactate synthase I; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see 2 papers)
41% identity, 98% coverage: 2:566/574 of query aligns to 92:657/667 of P09342
- C161 (≠ V71) modified: Disulfide link with 307
- P194 (≠ A104) mutation to Q: In C3; highly resistant to sulfonylurea herbicides.
- C307 (≠ A217) modified: Disulfide link with 161
P09114 Acetolactate synthase 2, chloroplastic; ALS II; Acetohydroxy-acid synthase II; Acetolactate synthase II; EC 2.2.1.6 from Nicotiana tabacum (Common tobacco) (see paper)
41% identity, 98% coverage: 2:566/574 of query aligns to 89:654/664 of P09114
- P191 (≠ A104) mutation to A: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with L-568.
- W568 (= W484) mutation to L: In S4-Hra; highly resistant to sulfonylurea herbicides; when associated with A-191.
6demA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide bensulfuron methyl (see paper)
41% identity, 99% coverage: 4:573/574 of query aligns to 12:583/597 of 6demA
- active site: Y33 (= Y25), G35 (= G27), G36 (= G28), A37 (= A29), I38 (≠ V30), E59 (= E51), T82 (= T74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), K228 (≠ Q224), M264 (= M260), V291 (≠ T287), V407 (= V395), L432 (= L420), G433 (= G421), M435 (= M423), D460 (= D448), N487 (= N475), E489 (≠ Y477), Q490 (≠ L478), M492 (= M480), V493 (= V481), W496 (= W484), L518 (= L507), N523 (≠ G512), V524 (≠ H513)
- binding methyl 2-[(4,6-dimethoxypyrimidin-2-yl)carbamoylsulfamoylmethyl]benzoate: M264 (= M260), D289 (= D285), R290 (= R286), M492 (= M480), W496 (= W484), A567 (≠ R559)
- binding flavin-adenine dinucleotide: R161 (= R153), G217 (= G214), A218 (≠ G215), G219 (= G216), N222 (vs. gap), T244 (≠ S240), L245 (= L241), Q246 (≠ M242), L262 (= L258), G284 (= G280), A285 (≠ V281), R286 (= R282), D288 (= D284), R290 (= R286), V291 (≠ T287), E317 (≠ D304), I318 (= I305), N322 (≠ S309), D336 (= D323), V337 (≠ A324), M412 (= M400), G430 (= G418)
- binding magnesium ion: D460 (= D448), N487 (= N475), E489 (≠ Y477)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V407 (= V395), G408 (= G396), Q409 (= Q397), H410 (= H398), M435 (= M423), G459 (= G447), D460 (= D448), A461 (≠ G449), S462 (= S450), M465 (= M453), N487 (= N475), E489 (≠ Y477), Q490 (≠ L478), G491 (= G479), M492 (= M480), V493 (= V481)
6delA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide chlorimuron ethyl (see paper)
41% identity, 99% coverage: 4:573/574 of query aligns to 12:583/597 of 6delA
- active site: Y33 (= Y25), G35 (= G27), G36 (= G28), A37 (= A29), I38 (≠ V30), E59 (= E51), T82 (= T74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), K228 (≠ Q224), M264 (= M260), V291 (≠ T287), V407 (= V395), L432 (= L420), G433 (= G421), M435 (= M423), D460 (= D448), N487 (= N475), E489 (≠ Y477), Q490 (≠ L478), M492 (= M480), V493 (= V481), W496 (= W484), L518 (= L507), N523 (≠ G512), V524 (≠ H513)
- binding 2-[[[[(4-chloro-6-methoxy-2-pyrimidinyl)amino]carbonyl]amino]sulfonyl]benzoic acid ethyl ester: D289 (= D285), R290 (= R286), W496 (= W484)
- binding flavin-adenine dinucleotide: R161 (= R153), G217 (= G214), A218 (≠ G215), G219 (= G216), N222 (vs. gap), T244 (≠ S240), L245 (= L241), Q246 (≠ M242), L262 (= L258), G284 (= G280), A285 (≠ V281), R286 (= R282), D288 (= D284), R290 (= R286), V291 (≠ T287), E317 (≠ D304), I318 (= I305), N322 (≠ S309), D336 (= D323), V337 (≠ A324), M412 (= M400), G430 (= G418)
- binding (3Z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl](formyl)amino}-3-sulfanylpent-3-en-1-yl trihydrogen diphosphate: V407 (= V395), G408 (= G396), Q409 (= Q397), H410 (= H398), G433 (= G421), M435 (= M423), G459 (= G447), D460 (= D448), A461 (≠ G449), S462 (= S450), M465 (= M453), N487 (= N475), E489 (≠ Y477), Q490 (≠ L478), G491 (= G479), M492 (= M480), V493 (= V481)
- binding magnesium ion: D460 (= D448), N487 (= N475), E489 (≠ Y477)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V407 (= V395), G408 (= G396), Q409 (= Q397), H410 (= H398), G433 (= G421), M435 (= M423), G459 (= G447), D460 (= D448), A461 (≠ G449), S462 (= S450), M465 (= M453), N487 (= N475), E489 (≠ Y477), Q490 (≠ L478), G491 (= G479), M492 (= M480), V493 (= V481)
6denA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide iodomuron ethyl (see paper)
41% identity, 99% coverage: 4:573/574 of query aligns to 14:585/599 of 6denA
- active site: Y35 (= Y25), G37 (= G27), G38 (= G28), A39 (= A29), I40 (≠ V30), E61 (= E51), T84 (= T74), F123 (= F113), Q124 (= Q114), E125 (= E115), K173 (= K163), K230 (≠ Q225), M266 (= M260), V293 (≠ T287), V409 (= V395), L434 (= L420), G435 (= G421), M437 (= M423), D462 (= D448), N489 (= N475), E491 (≠ Y477), Q492 (≠ L478), M494 (= M480), V495 (= V481), W498 (= W484), L520 (= L507), N525 (≠ G512), V526 (≠ H513)
- binding flavin-adenine dinucleotide: R163 (= R153), G219 (= G214), A220 (≠ G215), G221 (= G216), N224 (≠ T219), T246 (≠ S240), L247 (= L241), Q248 (≠ M242), L264 (= L258), G286 (= G280), A287 (≠ V281), R288 (= R282), D290 (= D284), R292 (= R286), V293 (≠ T287), E319 (≠ D304), I320 (= I305), N324 (≠ S309), D338 (= D323), V339 (≠ A324), M414 (= M400), G432 (= G418)
- binding ethyl 2-{[(4-iodo-6-methoxypyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: M266 (= M260), D291 (= D285), R292 (= R286), W498 (= W484)
- binding magnesium ion: D462 (= D448), N489 (= N475), E491 (≠ Y477)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V409 (= V395), G410 (= G396), Q411 (= Q397), H412 (= H398), G435 (= G421), M437 (= M423), G461 (= G447), D462 (= D448), A463 (≠ G449), S464 (= S450), N489 (= N475), E491 (≠ Y477), Q492 (≠ L478), G493 (= G479), M494 (= M480), V495 (= V481)
6derA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide metosulam (see paper)
41% identity, 99% coverage: 4:573/574 of query aligns to 14:586/600 of 6derA
- active site: Y35 (= Y25), G37 (= G27), G38 (= G28), A39 (= A29), I40 (≠ V30), E61 (= E51), T84 (= T74), F123 (= F113), Q124 (= Q114), E125 (= E115), K173 (= K163), K231 (≠ Q225), M267 (= M260), V294 (≠ T287), V410 (= V395), L435 (= L420), G436 (= G421), M438 (= M423), D463 (= D448), N490 (= N475), E492 (≠ Y477), Q493 (≠ L478), M495 (= M480), V496 (= V481), W499 (= W484), L521 (= L507), N526 (≠ G512), V527 (≠ H513)
- binding flavin-adenine dinucleotide: R163 (= R153), G220 (= G214), A221 (≠ G215), G222 (= G216), N225 (≠ T219), T247 (≠ S240), L248 (= L241), Q249 (≠ M242), L265 (= L258), H268 (= H261), G287 (= G280), A288 (≠ V281), R289 (= R282), D291 (= D284), R293 (= R286), V294 (≠ T287), E320 (≠ D304), I321 (= I305), N325 (≠ S309), G338 (= G322), D339 (= D323), V340 (≠ A324), Q414 (= Q399), M415 (= M400), G433 (= G418)
- binding Metosulam: R293 (= R286), M495 (= M480), W499 (= W484), A570 (≠ R559)
- binding magnesium ion: D463 (= D448), N490 (= N475), E492 (≠ Y477)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V410 (= V395), G411 (= G396), Q412 (= Q397), H413 (= H398), G436 (= G421), M438 (= M423), G462 (= G447), D463 (= D448), A464 (≠ G449), S465 (= S450), N490 (= N475), E492 (≠ Y477), Q493 (≠ L478), G494 (= G479), M495 (= M480), V496 (= V481)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V410 (= V395), G411 (= G396), Q412 (= Q397), H413 (= H398), G436 (= G421), M438 (= M423), G462 (= G447), D463 (= D448), A464 (≠ G449), S465 (= S450), M468 (= M453), N490 (= N475), E492 (≠ Y477), Q493 (≠ L478), G494 (= G479), V496 (= V481)
6deqA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide penoxsulam (see paper)
42% identity, 99% coverage: 4:573/574 of query aligns to 14:587/601 of 6deqA
- active site: Y35 (= Y25), G37 (= G27), G38 (= G28), A39 (= A29), I40 (≠ V30), E61 (= E51), T84 (= T74), F123 (= F113), Q124 (= Q114), E125 (= E115), K173 (= K163), K232 (≠ Q224), M268 (= M260), V295 (≠ T287), V411 (= V395), L436 (= L420), G437 (= G421), M439 (= M423), D464 (= D448), N491 (= N475), E493 (≠ Y477), Q494 (≠ L478), M496 (= M480), V497 (= V481), W500 (= W484), L522 (= L507), N527 (≠ G512), V528 (≠ H513)
- binding flavin-adenine dinucleotide: R163 (= R153), G221 (= G214), A222 (≠ G215), G223 (= G216), N226 (vs. gap), T248 (≠ S240), L249 (= L241), Q250 (≠ M242), L266 (= L258), G288 (= G280), A289 (≠ V281), R290 (= R282), D292 (= D284), R294 (= R286), V295 (≠ T287), E321 (≠ D304), I322 (= I305), D340 (= D323), V341 (≠ A324), M416 (= M400), G434 (= G418)
- binding magnesium ion: D464 (= D448), N491 (= N475), E493 (≠ Y477)
- binding 2-(2,2-difluoroethoxy)-N-(5,8-dimethoxy[1,2,4]triazolo[1,5-c]pyrimidin-2-yl)-6-(trifluoromethyl)benzenesulfonamide: M268 (= M260), R294 (= R286), M496 (= M480), V497 (= V481), W500 (= W484), A571 (≠ R559)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V411 (= V395), G412 (= G396), Q413 (= Q397), H414 (= H398), M439 (= M423), G463 (= G447), D464 (= D448), A465 (≠ G449), S466 (= S450), N491 (= N475), E493 (≠ Y477), Q494 (≠ L478), G495 (= G479), M496 (= M480), V497 (= V481)
6desA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide propoxycarbazone (see paper)
41% identity, 99% coverage: 4:573/574 of query aligns to 12:584/598 of 6desA
- active site: Y33 (= Y25), G35 (= G27), G36 (= G28), A37 (= A29), I38 (≠ V30), E59 (= E51), T82 (= T74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), K229 (≠ Q224), M265 (= M260), V292 (≠ T287), V408 (= V395), L433 (= L420), G434 (= G421), M436 (= M423), D461 (= D448), N488 (= N475), E490 (≠ Y477), Q491 (≠ L478), M493 (= M480), V494 (= V481), W497 (= W484), L519 (= L507), N524 (≠ G512), V525 (≠ H513)
- binding methyl 2-[(4-methyl-5-oxidanylidene-3-propoxy-1,2,4-triazol-1-yl)carbonylsulfamoyl]benzoate: M265 (= M260), D290 (= D285), R291 (= R286), W497 (= W484)
- binding flavin-adenine dinucleotide: R161 (= R153), G218 (= G214), A219 (≠ G215), G220 (= G216), N223 (vs. gap), T245 (≠ S240), L246 (= L241), Q247 (≠ M242), L263 (= L258), G285 (= G280), A286 (≠ V281), R287 (= R282), D289 (= D284), R291 (= R286), V292 (≠ T287), E318 (≠ D304), I319 (= I305), N323 (≠ S309), D337 (= D323), V338 (≠ A324), Q412 (= Q399), M413 (= M400), G431 (= G418)
- binding magnesium ion: D461 (= D448), N488 (= N475), E490 (≠ Y477)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V408 (= V395), G409 (= G396), Q410 (= Q397), H411 (= H398), G434 (= G421), M436 (= M423), G460 (= G447), D461 (= D448), A462 (≠ G449), S463 (= S450), N488 (= N475), E490 (≠ Y477), Q491 (≠ L478), G492 (= G479), M493 (= M480), V494 (= V481)
6depA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide sulfometuron methyl (see paper)
41% identity, 99% coverage: 4:573/574 of query aligns to 12:584/598 of 6depA
- active site: Y33 (= Y25), G35 (= G27), G36 (= G28), A37 (= A29), I38 (≠ V30), E59 (= E51), T82 (= T74), F121 (= F113), Q122 (= Q114), E123 (= E115), K171 (= K163), K229 (≠ Q224), M265 (= M260), V292 (≠ T287), V408 (= V395), L433 (= L420), G434 (= G421), M436 (= M423), D461 (= D448), N488 (= N475), E490 (≠ Y477), Q491 (≠ L478), M493 (= M480), V494 (= V481), W497 (= W484), L519 (= L507), N524 (≠ G512), V525 (≠ H513)
- binding methyl 2-[({[(4,6-dimethylpyrimidin-2-yl)amino]carbonyl}amino)sulfonyl]benzoate: D290 (= D285), R291 (= R286), M493 (= M480), W497 (= W484)
- binding flavin-adenine dinucleotide: R161 (= R153), G218 (= G214), A219 (≠ G215), G220 (= G216), N223 (vs. gap), T245 (≠ S240), L246 (= L241), Q247 (≠ M242), L263 (= L258), G264 (= G259), G285 (= G280), A286 (≠ V281), R287 (= R282), D289 (= D284), R291 (= R286), V292 (≠ T287), E318 (≠ D304), I319 (= I305), N323 (≠ S309), D337 (= D323), V338 (≠ A324), M413 (= M400), G431 (= G418)
- binding magnesium ion: D461 (= D448), N488 (= N475), E490 (≠ Y477)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V408 (= V395), G409 (= G396), Q410 (= Q397), H411 (= H398), G434 (= G421), M436 (= M423), G460 (= G447), D461 (= D448), A462 (≠ G449), S463 (= S450), M466 (= M453), N488 (= N475), E490 (≠ Y477), Q491 (≠ L478), G492 (= G479), M493 (= M480), V494 (= V481)
- binding 2-{3-[(4-amino-2-methylpyrimidin-5-yl)methyl]-4-methyl-2-oxo-2,3-dihydro-1,3-thiazol-5-yl}ethyl trihydrogendiphosphate: V408 (= V395), G409 (= G396), Q410 (= Q397), H411 (= H398), G434 (= G421), M436 (= M423), G460 (= G447), D461 (= D448), A462 (≠ G449), S463 (= S450), M466 (= M453), N488 (= N475), E490 (≠ Y477), Q491 (≠ L478), G492 (= G479), M493 (= M480), V494 (= V481)
6deoA Crystal structure of candida albicans acetohydroxyacid synthase in complex with the herbicide iodomuron methyl (see paper)
41% identity, 99% coverage: 4:573/574 of query aligns to 10:579/593 of 6deoA
- active site: Y31 (= Y25), G33 (= G27), G34 (= G28), A35 (= A29), I36 (≠ V30), E57 (= E51), T80 (= T74), F119 (= F113), Q120 (= Q114), E121 (= E115), K169 (= K163), K224 (≠ Q224), M260 (= M260), V287 (≠ T287), V403 (= V395), L428 (= L420), G429 (= G421), M431 (= M423), D456 (= D448), N483 (= N475), E485 (≠ Y477), Q486 (≠ L478), M488 (= M480), V489 (= V481), W492 (= W484), L514 (= L507), N519 (≠ G512), V520 (≠ H513)
- binding flavin-adenine dinucleotide: R159 (= R153), G213 (= G214), A214 (≠ G215), G215 (= G216), N218 (vs. gap), T240 (≠ S240), L241 (= L241), Q242 (≠ M242), L258 (= L258), G280 (= G280), A281 (≠ V281), R282 (= R282), D284 (= D284), R286 (= R286), V287 (≠ T287), E313 (≠ D304), I314 (= I305), N318 (≠ S309), D332 (= D323), V333 (≠ A324), M408 (= M400), G426 (= G418)
- binding methyl 2-{[(4-iodo-6-methoxypyrimidin-2-yl)carbamoyl]sulfamoyl}benzoate: M260 (= M260), D285 (= D285), R286 (= R286), M488 (= M480), W492 (= W484)
- binding magnesium ion: D456 (= D448), N483 (= N475), E485 (≠ Y477)
- binding (3z)-4-{[(4-amino-2-methylpyrimidin-5-yl)methyl]amino}-3-mercaptopent-3-en-1-yl trihydrogen diphosphate: V403 (= V395), G404 (= G396), Q405 (= Q397), H406 (= H398), G429 (= G421), M431 (= M423), G455 (= G447), D456 (= D448), A457 (≠ G449), S458 (= S450), M461 (= M453), N483 (= N475), E485 (≠ Y477), Q486 (≠ L478), G487 (= G479), M488 (= M480), V489 (= V481)
Query Sequence
>1936210 FitnessBrowser__Keio:1936210
MEMLSGAEMVVRSLIDQGVKQVFGYPGGAVLDIYDALHTVGGIDHVLVRHEQAAVHMADG
LARATGEVGVVLVTSGPGATNAITGIATAYMDSIPLVVLSGQVATSLIGYDAFQECDMVG
ISRPVVKHSFLVKQTEDIPQVLKKAFWLAASGRPGPVVVDLPKDILNPANKLPYVWPESV
SMRSYNPTTTGHKGQIKRALQTLVAAKKPVVYVGGGAITAGCHQQLKETVEALNLPVVCS
LMGLGAFPATHRQALGMLGMHGTYEANMTMHNADVIFAVGVRFDDRTTNNLAKYCPNATV
LHIDIDPTSISKTVTADIPIVGDARQVLEQMLELLSQESAHQPLDEIRDWWQQIEQWRAR
QCLKYDTHSEKIKPQAVIETLWRLTKGDAYVTSDVGQHQMFAALYYPFDKPRRWINSGGL
GTMGFGLPAALGVKMALPEETVVCVTGDGSIQMNIQELSTALQYELPVLVVNLNNRYLGM
VKQWQDMIYSGRHSQSYMQSLPDFVRLAEAYGHVGIQISHPHELESKLSEALEQVRNNRL
VFVDVTVDGSEHVYPMQIRGGGMDEMWLSKTERT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory