Comparing 1936449 FitnessBrowser__Keio:1936449 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
41% identity, 89% coverage: 19:317/337 of query aligns to 4:303/326 of Q8RDH4
Sites not aligning to the query:
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
40% identity, 89% coverage: 19:317/337 of query aligns to 3:292/310 of 4fwiB
Sites not aligning to the query:
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
37% identity, 93% coverage: 19:333/337 of query aligns to 3:325/330 of P0AAH4
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
34% identity, 75% coverage: 19:272/337 of query aligns to 3:247/250 of 7z18I
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
34% identity, 75% coverage: 19:272/337 of query aligns to 3:247/253 of 7z15I
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
33% identity, 75% coverage: 19:272/337 of query aligns to 3:247/250 of 7z16I
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 77% coverage: 19:276/337 of query aligns to 1:248/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
31% identity, 77% coverage: 19:276/337 of query aligns to 2:249/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
31% identity, 77% coverage: 19:276/337 of query aligns to 2:249/344 of 3tuiC
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
31% identity, 77% coverage: 19:276/337 of query aligns to 2:249/344 of 6cvlD
5xu1B Structure of a non-canonical abc transporter from streptococcus pneumoniae r6 (see paper)
34% identity, 62% coverage: 19:228/337 of query aligns to 3:202/226 of 5xu1B
3c4jA Abc protein artp in complex with atp-gamma-s
30% identity, 75% coverage: 19:272/337 of query aligns to 3:241/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
30% identity, 75% coverage: 19:272/337 of query aligns to 3:241/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
30% identity, 75% coverage: 19:272/337 of query aligns to 3:241/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
30% identity, 75% coverage: 19:272/337 of query aligns to 3:241/242 of 2oljA
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
31% identity, 71% coverage: 34:273/337 of query aligns to 17:247/375 of 2d62A
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
30% identity, 69% coverage: 34:264/337 of query aligns to 37:258/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
30% identity, 69% coverage: 34:264/337 of query aligns to 37:258/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
30% identity, 69% coverage: 34:264/337 of query aligns to 37:258/260 of 7ahdC
Sites not aligning to the query:
5d3mA Folate ecf transporter: amppnp bound state (see paper)
31% identity, 69% coverage: 26:257/337 of query aligns to 10:231/280 of 5d3mA
>1936449 FitnessBrowser__Keio:1936449
MSVIETATVPLAQQQADALLNVKDLRVTFSTPDGDVTAVNDLNFSLRAGETLGIVGESGS
GKSQTAFALMGLLAANGRIGGSATFNGREILNLPEHELNKLRAEQISMIFQDPMTSLNPY
MRVGEQLMEVLMLHKNMSKAEAFEESVRMLDAVKMPEARKRMKMYPHEFSGGMRQRVMIA
MALLCRPKLLIADEPTTALDVTVQAQIMTLLNELKREFNTAIIMITHDLVVVAGICDKVL
VMYAGRTMEYGNARDVFYQPVHPYSIGLLNAVPRLDAEGETMLTIPGNPPNLLRLPKGCP
FQPRCPHAMEICSSAPPLEEFTPGRLRACFKPVEELL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory