Comparing 1936527 FitnessBrowser__Keio:1936527 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
4im7A Crystal structure of fructuronate reductase (ydfi) from e. Coli cft073 (efi target efi-506389) complexed with nadh and d-mannonate
27% identity, 74% coverage: 17:372/483 of query aligns to 20:376/483 of 4im7A
7rk5B Mannitol-2-dehydrogenase bound to nadh from aspergillus fumigatus
26% identity, 83% coverage: 11:413/483 of query aligns to 29:437/501 of 7rk5B
1m2wA Pseudomonas fluorescens mannitol 2-dehydrogenase ternary complex with NAD and d-mannitol (see paper)
25% identity, 82% coverage: 16:413/483 of query aligns to 27:428/492 of 1m2wA
1lj8A Crystal structure of mannitol dehydrogenase in complex with NAD (see paper)
25% identity, 82% coverage: 16:413/483 of query aligns to 27:428/492 of 1lj8A
P09424 Mannitol-1-phosphate 5-dehydrogenase; EC 1.1.1.17 from Escherichia coli (strain K12) (see paper)
26% identity, 44% coverage: 167:377/483 of query aligns to 117:313/382 of P09424
Q4X1A4 Mannitol-1-phosphate 5-dehydrogenase; M1PDH; MPD; MPDH; EC 1.1.1.17 from Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) (Neosartorya fumigata) (see paper)
22% identity, 71% coverage: 16:356/483 of query aligns to 3:291/388 of Q4X1A4
>1936527 FitnessBrowser__Keio:1936527
MKTLNRRDFPGAQYPERIIQFGEGNFLRAFVDWQIDLLNEHTDLNSGVVVVRPIETSFPP
SLSTQDGLYTTIIRGLNEKGEAVSDARLIRSVNREISVYSEYDEFLKLAHNPEMRFVFSN
TTEAGISYHAGDKFDDAPAVSYPAKLTRLLFERFSHFNGALDKGWIIIPCELIDYNGDAL
RELVLRYAQEWALPEAFIQWLDQANSFCSTLVDRIVTGYPRDEVAKLEEELGYHDGFLDT
AEHFYLFVIQGPKSLATELRLDKYPLNVLIVDDIKPYKERKVAILNGAHTALVPVAFQAG
LDTVGEAMNDAEICAFVEKAIYEEIIPVLDLPRDELESFASAVTGRFRNPYIKHQLLSIA
LNGMTKFRTRILPQLLAGQKANGTLPARLTFALAALIAFYRGERNGETYPVQDDAHWLER
YQQLWSQHRDRVIGTQELVAIVLAEKDHWEQDLTQVPGLVEQVANDLDAILEKGMREAVR
PLC
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory