Comparing 1936874 FitnessBrowser__Keio:1936874 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q51742 Ornithine carbamoyltransferase, anabolic; OTCase; EC 2.1.3.3 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see 3 papers)
26% identity, 79% coverage: 22:333/396 of query aligns to 8:273/315 of Q51742
Sites not aligning to the query:
3kzkA Crystal structure of acetylornithine transcarbamylase complexed with acetylcitrulline (see paper)
29% identity, 79% coverage: 22:332/396 of query aligns to 2:294/334 of 3kzkA
Sites not aligning to the query:
Q8P8J2 N-acetylornithine carbamoyltransferase; N-acetyl-L-ornithine transcarbamylase; AOTCase; Acetylornithine transcarbamylase; EC 2.1.3.9 from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) (see 3 papers)
29% identity, 79% coverage: 22:332/396 of query aligns to 4:296/339 of Q8P8J2
Sites not aligning to the query:
3m4jA Crystal structure of n-acetyl-l-ornithine transcarbamylase complexed with palao (see paper)
29% identity, 79% coverage: 22:332/396 of query aligns to 2:294/332 of 3m4jA
Sites not aligning to the query:
3kzoA Crystal structure of n-acetyl-l-ornithine transcarbamylase complexed with carbamyl phosphate and n-acetyl-l-norvaline (see paper)
29% identity, 79% coverage: 22:332/396 of query aligns to 2:294/332 of 3kzoA
Sites not aligning to the query:
3kznA Crystal structure of n-acetyl-l-ornithine transcarbamylase complexed with n-acetyl-l-ornirthine (see paper)
29% identity, 79% coverage: 22:332/396 of query aligns to 2:294/332 of 3kznA
Sites not aligning to the query:
3kzmA Crystal structure of n-acetyl-l-ornithine transcarbamylase complexed with carbamyl phosphate (see paper)
29% identity, 79% coverage: 22:332/396 of query aligns to 2:294/332 of 3kzmA
Sites not aligning to the query:
3l02A Crystal structure of n-acetyl-l-ornithine transcarbamylase e92a mutant complexed with carbamyl phosphate and n-succinyl-l-norvaline (see paper)
29% identity, 79% coverage: 22:332/396 of query aligns to 2:294/332 of 3l02A
Sites not aligning to the query:
P00481 Ornithine transcarbamylase, mitochondrial; OTCase; Ornithine carbamoyltransferase, mitochondrial; EC 2.1.3.3 from Rattus norvegicus (Rat) (see 2 papers)
26% identity, 78% coverage: 66:374/396 of query aligns to 85:340/354 of P00481
Sites not aligning to the query:
Q837U7 Putrescine carbamoyltransferase; PTC; PTCase; Agmatine catabolism protein B; Putrescine transcarbamoylase; Putrescine transcarbamylase; EC 2.1.3.6 from Enterococcus faecalis (strain ATCC 700802 / V583) (see paper)
25% identity, 89% coverage: 21:373/396 of query aligns to 2:306/339 of Q837U7
4a8hA Crystal structure of putrescine transcarbamylase from enterococcus faecalis with n-(phosphonoacetyl)-putrescine (see paper)
25% identity, 89% coverage: 21:373/396 of query aligns to 2:306/340 of 4a8hA
4am8D Crystal structure of the r54g mutant of putrescine transcarbamylase from enterococcus faecalis bound to a curing guanidinium ion
25% identity, 89% coverage: 21:373/396 of query aligns to 2:306/349 of 4am8D
4am8A Crystal structure of the r54g mutant of putrescine transcarbamylase from enterococcus faecalis bound to a curing guanidinium ion
25% identity, 89% coverage: 21:373/396 of query aligns to 2:306/336 of 4am8A
Sites not aligning to the query:
Q81M99 Ornithine carbamoyltransferase; OTCase; EC 2.1.3.3 from Bacillus anthracis
26% identity, 90% coverage: 19:374/396 of query aligns to 9:307/316 of Q81M99
7nouA Crystal structure of mycobacterium tuberculosis argf in complex with (3,5-dichlorophenyl)boronic acid.
26% identity, 89% coverage: 22:373/396 of query aligns to 4:302/308 of 7nouA
7nosA Crystal structure of mycobacterium tuberculosis argf in complex with 4-bromo-6-(trifluoromethyl)-1h-benzo[d]imidazole.
26% identity, 89% coverage: 22:373/396 of query aligns to 4:302/308 of 7nosA
7norA Crystal structure of mycobacterium tuberculosis argf in complex with 2-fluoro-4-hydroxybenzonitrile.
26% identity, 89% coverage: 22:373/396 of query aligns to 4:302/308 of 7norA
7nnyA Crystal structure of mycobacterium tuberculosis argf in complex with naphthalen-1-ol.
26% identity, 89% coverage: 22:373/396 of query aligns to 4:302/308 of 7nnyA
7nnwA Crystal structure of mycobacterium tuberculosis argf in complex with methyl 4-hydroxy-3-iodobenzoate.
26% identity, 89% coverage: 22:373/396 of query aligns to 4:302/308 of 7nnwA
7nnvA Crystal structure of mycobacterium tuberculosis argf in complex with carbamoyl phosphate.
26% identity, 89% coverage: 22:373/396 of query aligns to 4:302/308 of 7nnvA
>1936874 FitnessBrowser__Keio:1936874
MMKTVNELIKDINSLTSHLHEKDFLLTWEQTPDELKQVLDVAAALKALRAENISTKVFNS
GLGISVFRDNSTRTRFSYASALNLLGLAQQDLDEGKSQIAHGETVRETANMISFCADAIG
IRDDMYLGAGNAYMREVGAALDDGYKQGVLPQRPALVNLQCDIDHPTQSMADLAWLREHF
GSLENLKGKKIAMTWAYSPSYGKPLSVPQGIIGLMTRFGMDVTLAHPEGYDLIPDVVEVA
KNNAKASGGSFRQVTSMEEAFKDADIVYPKSWAPYKVMEERTELLRANDHEGLKALEKQC
LAQNAQHKDWHCTEEMMELTRDGEALYMHCLPADISGVSCKEGEVTEGVFEKYRIATYKE
ASWKPYIIAAMILSRKYAKPGALLEQLLKEAQERVK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory