SitesBLAST
Comparing 1936889 FitnessBrowser__Keio:1936889 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P12311 Alcohol dehydrogenase; ADH-T; EC 1.1.1.1 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
27% identity, 84% coverage: 1:355/425 of query aligns to 1:325/337 of P12311
- C38 (= C39) mutation to S: No activity.
- T40 (≠ S41) mutation to A: No activity.; mutation to S: Little decrease in activity.
- H43 (≠ K44) mutation to A: No activity.; mutation to R: Higher level of activity at pH 9.
3meqA Crystal structure of alcohol dehydrogenase from brucella melitensis
24% identity, 82% coverage: 1:349/425 of query aligns to 3:323/341 of 3meqA
- active site: C40 (= C39), H41 (≠ L40), T42 (≠ S41), H45 (≠ K44), H63 (= H68), E64 (= E69), C94 (vs. gap), C97 (≠ S108), C100 (≠ Y111), C108 (≠ P122), L112 (≠ I126), C150 (vs. gap), T154 (= T162)
- binding 1,4-dihydronicotinamide adenine dinucleotide: C40 (= C39), H41 (≠ L40), T42 (≠ S41), H45 (≠ K44), C150 (vs. gap), T154 (= T162), G176 (= G185), G177 (≠ P186), L178 (≠ M187), D197 (= D209), I198 (= I210), K202 (≠ R214), T241 (≠ Y264), A242 (= A265), V243 (≠ A266), S244 (≠ V267), A247 (≠ V270), N264 (≠ F287), G265 (≠ A288), L266 (≠ G289), I289 (≠ S315), V290 (≠ G316)
- binding zinc ion: C40 (= C39), H63 (= H68), C94 (vs. gap), C97 (≠ S108), C100 (≠ Y111), C108 (≠ P122), C150 (vs. gap)
Sites not aligning to the query:
P27867 Sorbitol dehydrogenase; SDH; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.14; EC 1.1.1.9 from Rattus norvegicus (Rat) (see paper)
26% identity, 50% coverage: 8:221/425 of query aligns to 14:216/357 of P27867
- C45 (= C39) binding
- H70 (= H68) binding
- E71 (= E69) binding
- E156 (= E146) binding
- D204 (= D209) binding
- R209 (= R214) binding
Sites not aligning to the query:
- 273:275 binding
- 297:299 binding
6iqdA Crystal structure of alcohol dehydrogenase from geobacillus stearothermophilus (see paper)
26% identity, 77% coverage: 11:336/425 of query aligns to 10:306/336 of 6iqdA
- active site: C38 (= C39), T40 (≠ S41), H43 (≠ K44), H61 (= H68), C148 (vs. gap)
- binding zinc ion: C38 (= C39), H61 (= H68), E62 (= E69), C92 (≠ G106), C95 (≠ Y109), C98 (vs. gap), C106 (= C130), C148 (vs. gap)
2eerB Structural study of project id st2577 from sulfolobus tokodaii strain7
22% identity, 82% coverage: 12:358/425 of query aligns to 11:336/347 of 2eerB
- active site: C38 (= C39), H39 (≠ L40), S40 (= S41), H43 (≠ K44), H68 (= H68), E69 (= E69), E98 (≠ L99), C101 (≠ G102), C104 (≠ A105), C112 (≠ G113), R116 (≠ T117), C154 (= C150), T158 (= T162)
- binding nicotinamide-adenine-dinucleotide: C38 (= C39), H39 (≠ L40), S40 (= S41), H43 (≠ K44), C154 (= C150), T158 (= T162), G178 (≠ A182), G181 (= G185), G182 (= G188), L183 (≠ I189), D203 (= D209), V204 (≠ I210), R205 (≠ D211), L247 (≠ Y264), N248 (≠ A265), V270 (≠ L284), G271 (≠ N285), L272 (≠ F286), F273 (= F287), L295 (≠ S315), V296 (≠ G316)
- binding zinc ion: E98 (≠ L99), C101 (≠ G102), C104 (≠ A105), C112 (≠ G113)
Sites not aligning to the query:
1rjwA Crystal structure of NAD(+)-dependent alcohol dehydrogenase from bacillus stearothermophilus strain lld-r (see paper)
25% identity, 84% coverage: 1:355/425 of query aligns to 1:325/339 of 1rjwA
- active site: C38 (= C39), H39 (≠ L40), T40 (≠ S41), H43 (≠ K44), H61 (= H68), E62 (= E69), C92 (vs. gap), C95 (vs. gap), C98 (vs. gap), C106 (vs. gap), K110 (vs. gap), C148 (= C149), T152 (≠ G153)
- binding trifluoroethanol: T40 (≠ S41), C148 (= C149), I285 (≠ S315)
- binding zinc ion: C38 (= C39), H61 (= H68), C92 (vs. gap), C95 (vs. gap), C98 (vs. gap), C106 (vs. gap)
Sites not aligning to the query:
3piiA Crystal structure of mutant of ht- alcohol dehydrogenase with substrate analogue butyramide
25% identity, 84% coverage: 1:355/425 of query aligns to 1:325/337 of 3piiA
- active site: C38 (= C39), H39 (≠ L40), T40 (≠ S41), H43 (≠ K44), H61 (= H68), E62 (= E69), C92 (vs. gap), C95 (vs. gap), C98 (vs. gap), C106 (vs. gap), K110 (vs. gap), C148 (= C149), T152 (≠ G153)
- binding butyramide: T40 (≠ S41), H61 (= H68), W87 (≠ S101), C148 (= C149)
- binding zinc ion: C38 (= C39), H61 (= H68), E62 (= E69), C92 (vs. gap), C95 (vs. gap), C98 (vs. gap), C106 (vs. gap), C148 (= C149)
Sites not aligning to the query:
3qe3A Sheep liver sorbitol dehydrogenase (see paper)
25% identity, 50% coverage: 8:221/425 of query aligns to 8:210/351 of 3qe3A
- active site: C39 (= C39), G40 (≠ L40), S41 (= S41), H44 (vs. gap), H64 (= H68), E65 (= E69), R94 (≠ Y107), D97 (≠ E110), C100 (≠ G113), S108 (≠ I121), F112 (≠ A125), P151 (= P147), G155 (≠ I151)
- binding glycerol: Y45 (vs. gap), F54 (≠ D58), T116 (vs. gap)
- binding zinc ion: C39 (= C39), H64 (= H68), E65 (= E69)
Sites not aligning to the query:
1e3jA Ketose reductase (sorbitol dehydrogenase) from silverleaf whitefly (see paper)
29% identity, 28% coverage: 6:124/425 of query aligns to 5:110/348 of 1e3jA
- active site: C38 (= C39), G39 (≠ L40), S40 (= S41), H43 (≠ K44), H63 (= H68), E64 (= E69), C93 (≠ S101), C96 (≠ S104), C99 (≠ G113), C107 (≠ I121)
- binding zinc ion: C38 (= C39), H63 (= H68), E64 (= E69), C93 (≠ S101), C96 (≠ S104), C99 (≠ G113), C107 (≠ I121)
Sites not aligning to the query:
4z6kA Alcohol dehydrogenase from the antarctic psychrophile moraxella sp. Tae 123
25% identity, 79% coverage: 1:337/425 of query aligns to 1:307/345 of 4z6kA
- active site: C38 (= C39), H39 (≠ L40), T40 (≠ S41), H43 (≠ K44), H61 (= H68), E62 (= E69), C92 (≠ M97), C95 (vs. gap), C98 (vs. gap), C106 (vs. gap), Q110 (≠ L99), C148 (= C149), T152 (≠ G153)
- binding zinc ion: C38 (= C39), H61 (= H68), C92 (≠ M97), C95 (vs. gap), C98 (vs. gap), C106 (vs. gap), C148 (= C149)
Sites not aligning to the query:
Q8GIX7 Alcohol dehydrogenase; ADH; EC 1.1.1.1 from Moraxella sp. (strain TAE123) (see paper)
25% identity, 79% coverage: 1:337/425 of query aligns to 1:307/338 of Q8GIX7
- C38 (= C39) binding
- H61 (= H68) binding
- E62 (= E69) binding
- C92 (≠ M97) binding
- C95 (vs. gap) binding
- C98 (vs. gap) binding
- C106 (vs. gap) binding
- C148 (= C149) binding
P07846 Sorbitol dehydrogenase; SDH; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.14; EC 1.1.1.9 from Ovis aries (Sheep) (see paper)
24% identity, 50% coverage: 8:221/425 of query aligns to 12:213/354 of P07846
- C43 (= C39) binding
- Y49 (vs. gap) binding
- H67 (= H68) binding
- E68 (= E69) binding
- E153 (= E146) binding
Sites not aligning to the query:
5o9dA Crystal structure of r. Ruber adh-a, mutant y294f, w295a, y54f, f43h, h39y (see paper)
24% identity, 64% coverage: 63:334/425 of query aligns to 57:313/346 of 5o9dA
- active site: H62 (= H68), E63 (= E69), C92 (≠ A105), C95 (≠ S108), C98 (≠ Y111), C106 (≠ M119), A110 (≠ I126), D153 (≠ G153), T157 (≠ A157)
- binding (2~{S})-2-methylpentanedioic acid: H62 (= H68), D153 (≠ G153), F294 (≠ S315)
- binding nicotinamide-adenine-dinucleotide: D153 (≠ G153), T157 (≠ A157), V180 (≠ P186), G181 (≠ M187), G182 (= G188), L183 (≠ I189), D203 (= D209), L204 (≠ I210), R208 (= R214), S223 (≠ N238), F246 (≠ Y264), V247 (≠ A265), T252 (≠ V270), V269 (≠ F287), G270 (≠ A288), I271 (≠ G289), F294 (≠ S315)
- binding zinc ion: H62 (= H68), C92 (≠ A105), C95 (≠ S108), C98 (≠ Y111), C106 (≠ M119), D153 (≠ G153)
Sites not aligning to the query:
6ffxA Crystal structure of r. Ruber adh-a, mutant f43h (see paper)
24% identity, 64% coverage: 63:334/425 of query aligns to 57:313/346 of 6ffxA
- active site: H62 (= H68), D153 (≠ G153)
- binding nicotinamide-adenine-dinucleotide: D153 (≠ G153), T157 (≠ A157), V180 (≠ P186), G181 (≠ M187), G182 (= G188), L183 (≠ I189), D203 (= D209), L204 (≠ I210), R208 (= R214), S223 (≠ N238), F246 (≠ Y264), V247 (≠ A265), V269 (≠ F287)
- binding zinc ion: H62 (= H68), C92 (≠ A105), C95 (≠ S108), C98 (≠ Y111), C106 (≠ M119), D153 (≠ G153)
Sites not aligning to the query:
6z42A The low resolution structure of a zinc-dependent alcohol dehydrogenase from halomonas elongata.
23% identity, 82% coverage: 1:349/425 of query aligns to 4:319/336 of 6z42A
- active site: C41 (= C39), T43 (≠ S41), H46 (≠ K44), H64 (= H68), C148 (= C149)
- binding zinc ion: C41 (= C39), H64 (= H68), E65 (= E69), C95 (≠ A105), C98 (≠ S108), C101 (≠ Y111), C109 (vs. gap), C148 (= C149)
1pl6A Human sdh/nadh/inhibitor complex (see paper)
23% identity, 59% coverage: 8:257/425 of query aligns to 13:240/356 of 1pl6A
- active site: C44 (= C39), G45 (≠ L40), S46 (= S41), H49 (vs. gap), H69 (= H68), E70 (= E69), R99 (≠ Y107), D102 (≠ E110), C105 (≠ G113), S113 (≠ I121), F117 (≠ A125), P156 (= P147), G160 (≠ I151)
- binding 4-[2-(hydroxymethyl)pyrimidin-4-yl]-n,n-dimethylpiperazine-1-sulfonamide: C44 (= C39), S46 (= S41), I56 (≠ V55), F59 (≠ D58), H69 (= H68), E155 (= E146)
- binding nicotinamide-adenine-dinucleotide: G181 (= G185), P182 (= P186), I183 (= I189), D203 (= D209), L204 (≠ I210), R208 (= R214)
- binding zinc ion: C44 (= C39), H69 (= H68)
Sites not aligning to the query:
Q00796 Sorbitol dehydrogenase; SDH; (R,R)-butanediol dehydrogenase; L-iditol 2-dehydrogenase; Polyol dehydrogenase; Ribitol dehydrogenase; RDH; Xylitol dehydrogenase; XDH; EC 1.1.1.-; EC 1.1.1.4; EC 1.1.1.14; EC 1.1.1.56; EC 1.1.1.9 from Homo sapiens (Human) (see 10 papers)
23% identity, 59% coverage: 8:257/425 of query aligns to 14:241/357 of Q00796
- C45 (= C39) binding
- H70 (= H68) binding
- E71 (= E69) binding
- R110 (≠ T117) to P: in SORDD; results in protein aggregation
- H135 (≠ Y134) to R: in SORDD; results in protein aggregation
- A153 (≠ S143) to D: in SORDD; uncertain significance; results in protein aggregation; dbSNP:rs145813597
- I184 (= I189) binding
- D204 (= D209) binding
- R209 (= R214) binding
- Q239 (≠ D255) to L: in dbSNP:rs1042079
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 269 N → T: in dbSNP:rs930337
- 273:275 binding
- 297:299 binding
- 322 V → I: in SORDD; uncertain significance; dbSNP:rs149975952
7y9pA Xylitol dehydrogenase s96c/s99c/y102c mutant(thermostabilized form) from pichia stipitis (see paper)
24% identity, 49% coverage: 13:221/425 of query aligns to 13:214/357 of 7y9pA
1r37A Alcohol dehydrogenase from sulfolobus solfataricus complexed with NAD(h) and 2-ethoxyethanol (see paper)
22% identity, 82% coverage: 12:358/425 of query aligns to 11:336/347 of 1r37A
- active site: C38 (= C39), H39 (≠ L40), S40 (= S41), H43 (≠ K44), H68 (= H68), E69 (= E69), E98 (≠ L99), C101 (≠ G102), C104 (≠ A105), C112 (≠ G113), R116 (≠ T117), C154 (= C150), T158 (= T162)
- binding 2-ethoxyethanol: S40 (= S41), F49 (≠ S50)
- binding nicotinamide-adenine-dinucleotide: C38 (= C39), H39 (≠ L40), S40 (= S41), H43 (≠ K44), C154 (= C150), T158 (= T162), G181 (= G185), G182 (≠ P186), L183 (≠ M187), D203 (= D209), V204 (≠ I210), R205 (≠ D211), L247 (≠ Y264), N248 (≠ A265), V270 (≠ L284), G271 (≠ N285), L272 (≠ F286), F273 (= F287), L295 (≠ S315), V296 (≠ G316), L334 (= L356)
- binding zinc ion: C38 (= C39), H68 (= H68), E98 (≠ L99), C101 (≠ G102), C104 (≠ A105), C112 (≠ G113), C154 (= C150)
Sites not aligning to the query:
1jvbA Alcohol dehydrogenase from the archaeon sulfolobus solfataricus (see paper)
22% identity, 82% coverage: 12:358/425 of query aligns to 11:336/347 of 1jvbA
- active site: C38 (= C39), H39 (≠ L40), S40 (= S41), H43 (≠ K44), H68 (= H68), E69 (= E69), E98 (≠ L99), C101 (≠ G102), C104 (≠ A105), C112 (≠ G113), R116 (≠ T117), C154 (= C150), T158 (= T162)
- binding zinc ion: C38 (= C39), H68 (= H68), E69 (= E69), E98 (≠ L99), C101 (≠ G102), C104 (≠ A105), C112 (≠ G113), C154 (= C150)
Sites not aligning to the query:
Query Sequence
>1936889 FitnessBrowser__Keio:1936889
MKTKVAAIYGKRDVRLRVFELPEITDNELLVSVISDSVCLSTWKAALLGSEHKRVPDDLE
NHPVITGHECAGVIVEVGKNLTGKYKKGQRFVLQPAMGLPSGYSAGYSYEYFGGNATYMI
IPEIAINLGCVLPYHGSYFAAASLAEPMCCIIGAYHANYHTTQYVYEHRMGVKPGGNIAL
LACAGPMGIGAIDYAINGGIQPSRVVVVDIDDKRLAQVQKLLPVELAASKGIELVYVNTK
GMSDPVQMLRALTGDAGFDDIFVYAAVPAVVEMADELLAEDGCLNFFAGPTDKNFKVPFN
FYNVHYNSTHVVGTSGGSTDDMKEAIALSATGQLQPSFMVTHIGGLDAVPETVLNLPDIP
GGKKLIYNGVTMPLTAIADFAEKGKTDPLFKELARLVEETHGIWNEQAEKYLLAQFGVDI
GEAAQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory