SitesBLAST
Comparing 1936904 FitnessBrowser__Keio:1936904 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
31% identity, 47% coverage: 18:180/350 of query aligns to 64:226/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ I27), G75 (= G29), S76 (= S30), G77 (≠ N31), T78 (≠ S32), G79 (≠ A34), L80 (≠ F35), A83 (≠ R38), C84 (≠ P39), P137 (= P89), G138 (= G93), E139 (= E94), A142 (= A96), T143 (= T97), G146 (= G100), N147 (≠ M101), S149 (≠ A103), T150 (≠ C104), A152 (≠ L106), G153 (≠ A107), E203 (≠ Y157), G204 (= G158), I209 (≠ L163)
Sites not aligning to the query:
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
25% identity, 46% coverage: 53:213/350 of query aligns to 96:257/456 of 8jdsA
- binding flavin-adenine dinucleotide: P132 (= P89), G133 (= G93), A134 (≠ E94), G140 (= G100), M141 (= M101), A143 (= A103), T144 (≠ C104), A146 (≠ L106), S147 (≠ A107), E200 (≠ Y157), G201 (= G158), I206 (≠ L163)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 32, 68, 70, 71, 72, 73, 74, 78, 79, 90, 323, 414, 415, 451
- binding manganese (ii) ion: 370, 377, 414
- binding pyruvic acid: 319, 370, 377, 415
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
25% identity, 46% coverage: 53:213/350 of query aligns to 96:257/456 of 8jdrA
- binding flavin-adenine dinucleotide: P132 (= P89), G133 (= G93), A134 (≠ E94), G140 (= G100), M141 (= M101), A143 (= A103), T144 (≠ C104), A146 (≠ L106), S147 (≠ A107), E200 (≠ Y157), G201 (= G158), I206 (≠ L163)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 324, 370, 414, 451
- binding (2R,3S)-3-methyl-2-oxidanyl-pentanoic acid: 319, 323, 415
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
25% identity, 46% coverage: 53:213/350 of query aligns to 96:257/456 of 8jdqA
- binding flavin-adenine dinucleotide: P132 (= P89), G133 (= G93), A134 (≠ E94), G140 (= G100), M141 (= M101), A143 (= A103), T144 (≠ C104), A146 (≠ L106), S147 (≠ A107), E200 (≠ Y157), G201 (= G158), I206 (≠ L163)
Sites not aligning to the query:
- binding (2R)-2-hydroxy-4-methylpentanoic acid: 319, 323, 370, 415
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 370, 414, 451
8jdoA Crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid (see paper)
25% identity, 46% coverage: 53:213/350 of query aligns to 96:257/456 of 8jdoA
- binding flavin-adenine dinucleotide: P132 (= P89), G133 (= G93), A134 (≠ E94), G140 (= G100), M141 (= M101), A143 (= A103), T144 (≠ C104), A146 (≠ L106), S147 (≠ A107), E200 (≠ Y157), G201 (= G158), I206 (≠ L163)
Sites not aligning to the query:
- binding (2R)-2-hydroxyhexanoic acid: 319, 323, 415
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 324, 370, 414, 451
8jdnA Crystal structure of h405a mldhd in complex with d-2-hydroxyvaleric acid (see paper)
25% identity, 46% coverage: 53:213/350 of query aligns to 96:257/456 of 8jdnA
- binding flavin-adenine dinucleotide: P132 (= P89), G133 (= G93), A134 (≠ E94), G140 (= G100), M141 (= M101), A143 (= A103), T144 (≠ C104), A146 (≠ L106), S147 (≠ A107), E200 (≠ Y157), G201 (= G158), I206 (≠ L163)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 370, 414, 451
- binding (2R)-2-oxidanylpentanoic acid: 319, 323, 415
8jdgA Crystal structure of h405a mldhd in complex with d-2-hydroxybutanoic acid (see paper)
25% identity, 46% coverage: 53:213/350 of query aligns to 96:257/456 of 8jdgA
- binding flavin-adenine dinucleotide: P132 (= P89), G133 (= G93), A134 (≠ E94), G140 (= G100), M141 (= M101), A143 (= A103), T144 (≠ C104), A146 (≠ L106), S147 (≠ A107), E200 (≠ Y157), G201 (= G158), I206 (≠ L163)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 370, 414, 451
- binding (2R)-2-oxidanylbutanoic acid: 319, 415
8jdbA Crystal structure of h405a mldhd in complex with d-2-hydroxyoctanoic acid (see paper)
25% identity, 46% coverage: 53:213/350 of query aligns to 96:257/456 of 8jdbA
- binding flavin-adenine dinucleotide: P132 (= P89), G133 (= G93), A134 (≠ E94), G140 (= G100), M141 (= M101), A143 (= A103), T144 (≠ C104), A146 (≠ L106), S147 (≠ A107), E200 (≠ Y157), G201 (= G158), I206 (≠ L163)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 324, 370, 414, 451
- binding (2R)-2-oxidanyloctanoic acid: 75, 319, 323, 415
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
25% identity, 46% coverage: 53:213/350 of query aligns to 96:257/454 of 8jdvA
- binding flavin-adenine dinucleotide: P132 (= P89), G133 (= G93), A134 (≠ E94), G140 (= G100), M141 (= M101), A143 (= A103), T144 (≠ C104), A146 (≠ L106), S147 (≠ A107), E200 (≠ Y157), G201 (= G158), I206 (≠ L163)
Sites not aligning to the query:
- binding 2-Ketohexanoic acid: 75, 317, 321, 368, 375, 413
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 321, 322, 412, 413, 449
- binding manganese (ii) ion: 368, 375, 412
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
25% identity, 46% coverage: 53:213/350 of query aligns to 96:257/455 of 8jdtA
- binding flavin-adenine dinucleotide: P132 (= P89), G133 (= G93), A134 (≠ E94), G140 (= G100), M141 (= M101), A143 (= A103), T144 (≠ C104), A146 (≠ L106), S147 (≠ A107), E200 (≠ Y157), G201 (= G158), I206 (≠ L163)
Sites not aligning to the query:
- binding 2-ketobutyric acid: 318, 369, 376, 414
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 322, 413, 414, 450
- binding manganese (ii) ion: 369, 376, 413
8jdpA Crystal structure of h405a mldhd in complex with d-2-hydroxyisovaleric acid (see paper)
25% identity, 46% coverage: 53:213/350 of query aligns to 96:257/455 of 8jdpA
- binding flavin-adenine dinucleotide: P132 (= P89), G133 (= G93), A134 (≠ E94), G140 (= G100), M141 (= M101), A143 (= A103), T144 (≠ C104), A146 (≠ L106), S147 (≠ A107), E200 (≠ Y157), G201 (= G158), I206 (≠ L163)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 369, 413, 450
- binding deaminohydroxyvaline: 319, 414
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
25% identity, 46% coverage: 53:213/350 of query aligns to 96:257/455 of 8jdeA
- binding flavin-adenine dinucleotide: P132 (= P89), G133 (= G93), A134 (≠ E94), G140 (= G100), M141 (= M101), A143 (= A103), T144 (≠ C104), A146 (≠ L106), S147 (≠ A107), E200 (≠ Y157), G201 (= G158), I206 (≠ L163)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 322, 413, 414, 450
- binding lactic acid: 318, 369, 376, 414
- binding manganese (ii) ion: 369, 376, 413
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
25% identity, 46% coverage: 53:213/350 of query aligns to 96:257/455 of 8jdxA
- binding flavin-adenine dinucleotide: P132 (= P89), G133 (= G93), A134 (≠ E94), G140 (= G100), M141 (= M101), A143 (= A103), T144 (≠ C104), A146 (≠ L106), S147 (≠ A107), E200 (≠ Y157), G201 (= G158), I206 (≠ L163)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 32, 68, 70, 71, 72, 73, 74, 78, 79, 90, 322, 413, 414, 450
- binding 3-methyl-2-oxobutanoic acid: 318, 369, 376, 414
- binding manganese (ii) ion: 369, 376, 413
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
25% identity, 46% coverage: 53:213/350 of query aligns to 96:257/455 of 8jduA
- binding flavin-adenine dinucleotide: P132 (= P89), G133 (= G93), A134 (≠ E94), G140 (= G100), M141 (= M101), A143 (= A103), T144 (≠ C104), A146 (≠ L106), S147 (≠ A107), E200 (≠ Y157), G201 (= G158), I206 (≠ L163)
Sites not aligning to the query:
- binding 2-oxopentanoic acid: 318, 322, 369, 376, 414
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 322, 413, 450
- binding manganese (ii) ion: 369, 376, 413
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
25% identity, 46% coverage: 53:213/350 of query aligns to 96:257/454 of 8jdzA
- binding flavin-adenine dinucleotide: P132 (= P89), G133 (= G93), A134 (≠ E94), G140 (= G100), M141 (= M101), A143 (= A103), T144 (≠ C104), A146 (≠ L106), S147 (≠ A107), E200 (≠ Y157), G201 (= G158), I206 (≠ L163)
Sites not aligning to the query:
- binding (3S)-3-methyl-2-oxopentanoic acid: 318, 322, 369, 376, 413
- binding flavin-adenine dinucleotide: 32, 68, 70, 71, 72, 73, 74, 78, 79, 90, 322, 412, 413, 449
- binding manganese (ii) ion: 369, 376, 412
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
25% identity, 46% coverage: 53:213/350 of query aligns to 96:257/454 of 8jdyA
- binding flavin-adenine dinucleotide: P132 (= P89), G133 (= G93), A134 (≠ E94), G140 (= G100), M141 (= M101), A143 (= A103), T144 (≠ C104), A146 (≠ L106), S147 (≠ A107), E200 (≠ Y157), G201 (= G158), I206 (≠ L163)
Sites not aligning to the query:
- binding 2-oxo-4-methylpentanoic acid: 318, 322, 336, 369, 376, 413
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 412, 449
- binding manganese (ii) ion: 369, 376, 412
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
27% identity, 48% coverage: 10:176/350 of query aligns to 55:219/465 of 3pm9A
- active site: A149 (≠ L106), L159 (≠ S116)
- binding flavin-adenine dinucleotide: P69 (≠ I27), Q70 (= Q28), G71 (= G29), G72 (≠ S30), N73 (= N31), T74 (≠ S32), G75 (≠ K33), L76 (≠ A34), G79 (= G37), Q80 (≠ R38), L91 (≠ V47), L133 (≠ P89), G134 (≠ P90), A135 (≠ H91), C139 (≠ A96), T140 (= T97), G142 (= G99), G143 (= G100), S146 (≠ A103), T147 (≠ C104), A149 (≠ L106), G150 (≠ A107), E200 (≠ Y157), G201 (= G158), I205 (≠ V162), I206 (≠ L163)
Sites not aligning to the query:
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
29% identity, 50% coverage: 38:211/350 of query aligns to 80:253/459 of P9WIT1
Sites not aligning to the query:
- 354 modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
28% identity, 35% coverage: 53:176/350 of query aligns to 103:225/466 of 6lpxA
- binding flavin-adenine dinucleotide: L139 (≠ P89), G140 (≠ P90), A141 (≠ H91), C145 (≠ A96), G149 (= G100), N150 (≠ M101), A152 (= A103), T153 (≠ C104), G157 (= G108), G207 (= G158), I212 (≠ L163)
Sites not aligning to the query:
- binding 2-oxoglutaric acid: 333, 337, 348, 379, 381, 388, 423
- binding flavin-adenine dinucleotide: 39, 75, 76, 77, 78, 79, 80, 81, 82, 85, 86, 422, 459
- binding zinc ion: 381, 388, 422
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
28% identity, 35% coverage: 53:176/350 of query aligns to 103:225/466 of 6lpuA
- binding flavin-adenine dinucleotide: L139 (≠ P89), G140 (≠ P90), A141 (≠ H91), C145 (≠ A96), H146 (≠ T97), G148 (= G99), G149 (= G100), N150 (≠ M101), A152 (= A103), T153 (≠ C104), A155 (≠ L106), E206 (≠ Y157), G207 (= G158), I211 (≠ V162), I212 (≠ L163)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 39, 75, 77, 78, 79, 80, 81, 85, 86, 422, 459
- binding (2s)-2-hydroxypentanedioic acid: 333, 337, 348, 379, 381, 388, 423
- binding zinc ion: 381, 388, 422
Query Sequence
>1936904 FitnessBrowser__Keio:1936904
MLRECDYSQALLEQVNQAISDKTPLVIQGSNSKAFLGRPVTGQTLDVRCHRGIVNYDPTE
LVITARVGTPLVTIEAALESAGQMLPCEPPHYGEEATWGGMVACGLAGPRRPWSGSVRDF
VLGTRIITGAGKHLRFGGEVMKNVAGYDLSRLMVGSYGCLGVLTEISMKVLPRPRASLSL
RREISLQEAMSEIAEWQLQPLPISGLCYFDNALWIRLEGGEGSVKAARELLGGEEVAGQF
WQQLREQQLPFFSLPGTLWRISLPSDAPMMDLPGEQLIDWGGALRWLKSTAEDNQIHRIA
RNAGGHATRFSAGDGGFAPLSAPLFRYHQQLKQQLDPCGVFNPGRMYAEL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory