Comparing 1937025 FitnessBrowser__Keio:1937025 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1z18A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound valine (see paper)
100% identity, 94% coverage: 24:367/367 of query aligns to 1:344/344 of 1z18A
1z17A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound ligand isoleucine (see paper)
100% identity, 94% coverage: 24:367/367 of query aligns to 1:344/344 of 1z17A
1z16A Crystal structure analysis of periplasmic leu/ile/val-binding protein with bound leucine (see paper)
100% identity, 94% coverage: 24:367/367 of query aligns to 1:344/344 of 1z16A
1uskA L-leucine-binding protein with leucine bound (see paper)
79% identity, 93% coverage: 24:366/367 of query aligns to 1:345/345 of 1uskA
1usiA L-leucine-binding protein with phenylalanine bound (see paper)
79% identity, 93% coverage: 24:366/367 of query aligns to 1:345/345 of 1usiA
4n0qB Crystal structure of an abc transporter, substrate-binding protein from brucella melitensis 16m in complex with l-leucine using a crystal grown in a crystal former (microlytic)
42% identity, 91% coverage: 25:357/367 of query aligns to 2:337/345 of 4n0qB
3ip9A Structure of atu2422-gaba receptor in complex with gaba (see paper)
40% identity, 91% coverage: 25:357/367 of query aligns to 2:335/348 of 3ip9A
3ip7A Structure of atu2422-gaba receptor in complex with valine (see paper)
40% identity, 91% coverage: 25:357/367 of query aligns to 2:335/348 of 3ip7A
3ip6A Structure of atu2422-gaba receptor in complex with proline (see paper)
40% identity, 91% coverage: 25:357/367 of query aligns to 2:335/348 of 3ip6A
3ip5A Structure of atu2422-gaba receptor in complex with alanine (see paper)
40% identity, 91% coverage: 25:357/367 of query aligns to 2:335/348 of 3ip5A
3ipcA Structure of atu2422-gaba f77a mutant receptor in complex with leucine (see paper)
40% identity, 91% coverage: 25:357/367 of query aligns to 2:335/348 of 3ipcA
4q6bA Crystal structure of abc transporter substrate-binding protein fromdesulfitobacterium hafniense complex with leu
31% identity, 84% coverage: 37:346/367 of query aligns to 10:316/335 of 4q6bA
4mlcA Abc transporter substrate-binding protein fromdesulfitobacterium hafniense
30% identity, 84% coverage: 37:346/367 of query aligns to 10:317/336 of 4mlcA
4gnrA 1.0 angstrom resolution crystal structure of the branched-chain amino acid transporter substrate binding protein livj from streptococcus pneumoniae str. Canada mdr_19a in complex with isoleucine
27% identity, 86% coverage: 26:342/367 of query aligns to 3:321/348 of 4gnrA
3td9A Crystal structure of a leucine binding protein livk (tm1135) from thermotoga maritima msb8 at 1.90 a resolution
27% identity, 87% coverage: 26:346/367 of query aligns to 2:324/350 of 3td9A
4q6wA Crystal structure of periplasmic binding protein type 1 from bordetella pertussis tohama i complexed with 3-hydroxy benzoic acid
27% identity, 74% coverage: 23:292/367 of query aligns to 1:277/376 of 4q6wA
3i45A Crystal structure of putative twin-arginine translocation pathway signal protein from rhodospirillum rubrum atcc 11170
24% identity, 80% coverage: 48:340/367 of query aligns to 26:327/378 of 3i45A
4rdcA The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with proline
21% identity, 82% coverage: 26:325/367 of query aligns to 3:305/364 of 4rdcA
Sites not aligning to the query:
4qymA The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with methionine
21% identity, 82% coverage: 26:325/367 of query aligns to 3:305/364 of 4qymA
Sites not aligning to the query:
4otzA The crystal structure of a solute-binding protein (n280d mutant) from anabaena variabilis atcc 29413 in complex with cystein
21% identity, 82% coverage: 26:325/367 of query aligns to 3:305/364 of 4otzA
Sites not aligning to the query:
>1937025 FitnessBrowser__Keio:1937025
MNIKGKALLAGCIALAFSNMALAEDIKVAVVGAMSGPVAQYGDQEFTGAEQAVADINAKG
GIKGNKLQIVKYDDACDPKQAVAVANKVVNDGIKYVIGHLCSSSTQPASDIYEDEGILMI
TPAATAPELTARGYQLILRTTGLDSDQGPTAAKYILEKVKPQRIAIVHDKQQYGEGLARA
VQDGLKKGNANVVFFDGITAGEKDFSTLVARLKKENIDFVYYGGYHPEMGQILRQARAAG
LKTQFMGPEGVANVSLSNIAGESAEGLLVTKPKNYDQVPANKPIVDAIKAKKQDPSGAFV
WTTYAALQSLQAGLNQSDDPAEIAKYLKANSVDTVMGPLTWDEKGDLKGFEFGVFDWHAN
GTATDAK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory