SitesBLAST
Comparing 1937129 FitnessBrowser__Keio:1937129 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P27830 dTDP-glucose 4,6-dehydratase 2; EC 4.2.1.46 from Escherichia coli (strain K12) (see 2 papers)
100% identity, 100% coverage: 1:355/355 of query aligns to 1:355/355 of P27830
- FI 12:13 (= FI 12:13) binding
- DKLT 33:36 (= DKLT 33:36) binding
- DI 59:60 (= DI 59:60) binding
- T100 (= T100) binding
- D135 (= D135) active site, Proton donor
- E136 (= E136) active site, Proton acceptor
- Y160 (= Y160) active site, Proton acceptor
- YSASK 160:164 (= YSASK 160:164) binding
- N190 (= N190) binding
1bxkB Dtdp-glucose 4,6-dehydratase from e. Coli
98% identity, 99% coverage: 1:350/355 of query aligns to 1:344/344 of 1bxkB
- active site: S125 (= S125), T134 (= T134), D135 (= D135), E136 (= E136), S158 (= S158), Y160 (= Y160), S161 (= S161), K164 (= K164)
- binding nicotinamide-adenine-dinucleotide: G8 (= G8), G11 (= G11), F12 (= F12), I13 (= I13), D33 (= D33), K34 (= K34), L35 (= L35), T36 (= T36), A38 (= A38), G39 (= G39), D59 (= D59), I60 (= I60), L81 (= L81), A83 (= A83), T100 (= T100), I132 (= I132), S133 (= S133), T134 (= T134), K164 (= K164), C187 (= C187)
1kewA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from salmonella enterica serovar typhimurium with thymidine diphosphate bound (see paper)
73% identity, 97% coverage: 3:347/355 of query aligns to 2:350/361 of 1kewA
- active site: T133 (= T134), D134 (= D135), E135 (= E136), L152 (vs. gap), L154 (≠ F147), F155 (= F148), T158 (= T151), Y167 (= Y160), K171 (= K164)
- binding nicotinamide-adenine-dinucleotide: G10 (= G11), F11 (= F12), I12 (= I13), D32 (= D33), K33 (= K34), L34 (= L35), T35 (= T36), A37 (= A38), G38 (= G39), D58 (= D59), I59 (= I60), L80 (= L81), A81 (= A82), A82 (= A83), S84 (= S85), T99 (= T100), I131 (= I132), S132 (= S133), T133 (= T134), Y167 (= Y160), K171 (= K164), C194 (= C187), N196 (= N189), N197 (= N190)
- binding thymidine-5'-diphosphate: E135 (= E136), N196 (= N189), K206 (= K199), L207 (= L200), P222 (= P215), Y224 (= Y217), R231 (= R224), N266 (= N259), R297 (= R294), H300 (= H297)
Sites not aligning to the query:
1keuA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from salmonella enterica serovar typhimurium with dtdp-d-glucose bound (see paper)
73% identity, 97% coverage: 3:347/355 of query aligns to 2:350/361 of 1keuA
- active site: T133 (= T134), D134 (= D135), E135 (= E136), L152 (vs. gap), L154 (≠ F147), F155 (= F148), T158 (= T151), Y167 (= Y160), K171 (= K164)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S84 (= S85), T133 (= T134), D134 (= D135), E135 (= E136), Y167 (= Y160), N196 (= N189), K206 (= K199), L207 (= L200), P222 (= P215), Y224 (= Y217), R231 (= R224), N266 (= N259), R297 (= R294), H300 (= H297)
- binding nicotinamide-adenine-dinucleotide: G10 (= G11), F11 (= F12), I12 (= I13), D32 (= D33), K33 (= K34), L34 (= L35), T35 (= T36), G38 (= G39), D58 (= D59), L80 (= L81), A81 (= A82), A82 (= A83), S84 (= S85), T99 (= T100), S132 (= S133), T133 (= T134), Y167 (= Y160), K171 (= K164), C194 (= C187), N196 (= N189), N197 (= N190)
Sites not aligning to the query:
P26391 dTDP-glucose 4,6-dehydratase; EC 4.2.1.46 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
73% identity, 97% coverage: 3:347/355 of query aligns to 2:350/361 of P26391
Sites not aligning to the query:
8du1A Crystal structure of NAD bound dtdp-glucose 4,6-dehydratase from elizabethkingia anophelis
54% identity, 98% coverage: 1:347/355 of query aligns to 3:353/361 of 8du1A
- binding nicotinamide-adenine-dinucleotide: G10 (= G8), G13 (= G11), F14 (= F12), I15 (= I13), D36 (= D33), A37 (≠ K34), L38 (= L35), T39 (= T36), G42 (= G39), D62 (= D59), I63 (= I60), L84 (= L81), A85 (= A82), A86 (= A83), T103 (= T100), S143 (= S133), T144 (= T134), Y169 (= Y160), K173 (= K164), C196 (= C187)
2hunA Crystal structure of hypothetical protein ph0414 from pyrococcus horikoshii ot3
48% identity, 96% coverage: 3:343/355 of query aligns to 3:318/329 of 2hunA
- active site: T125 (= T134), D126 (= D135), E127 (= E136), Y149 (= Y160), K153 (= K164)
- binding nicotinamide-adenine-dinucleotide: G8 (= G8), G11 (= G11), F12 (= F12), I13 (= I13), D34 (= D33), K35 (= K34), S40 (≠ G39), D60 (= D59), V61 (≠ I60), L80 (= L81), A81 (= A82), A82 (= A83), S99 (≠ T100), T125 (= T134), K153 (= K164), C176 (= C187), T177 (≠ S188), N178 (= N189), N179 (= N190)
1kerB The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from streptococcus suis with dtdp-d-glucose bound (see paper)
47% identity, 95% coverage: 1:339/355 of query aligns to 3:329/347 of 1kerB
- active site: T124 (= T134), D125 (= D135), E126 (= E136), Y160 (= Y160), K164 (= K164)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S85 (= S85), N87 (≠ V87), T124 (= T134), D125 (= D135), E126 (= E136), Y160 (= Y160), N189 (= N189), K199 (= K199), F200 (≠ L200), R203 (≠ L203), Q204 (≠ M204), K215 (≠ P215), L216 (≠ V216), Y217 (= Y217), R224 (= R224), N259 (= N259), R283 (= R294), H286 (= H297)
- binding nicotinamide-adenine-dinucleotide: G13 (= G11), F14 (= F12), I15 (= I13), D36 (= D33), K37 (= K34), L38 (= L35), T39 (= T36), G42 (= G39), D61 (= D59), I62 (= I60), Y81 (≠ L81), A82 (= A82), A83 (= A83), S85 (= S85), T100 (= T100), S123 (= S133), T124 (= T134), Y160 (= Y160), K164 (= K164), C187 (= C187), N190 (= N190)
1ketA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from streptococcus suis with thymidine diphosphate bound (see paper)
47% identity, 95% coverage: 1:339/355 of query aligns to 2:328/346 of 1ketA
- active site: T123 (= T134), D124 (= D135), E125 (= E136), Y159 (= Y160), K163 (= K164)
- binding nicotinamide-adenine-dinucleotide: G12 (= G11), F13 (= F12), I14 (= I13), D35 (= D33), K36 (= K34), L37 (= L35), T38 (= T36), A40 (= A38), G41 (= G39), D60 (= D59), I61 (= I60), Y80 (≠ L81), A82 (= A83), S84 (= S85), T99 (= T100), S122 (= S133), T123 (= T134), Y159 (= Y160), K163 (= K164)
- binding thymidine-5'-diphosphate: E125 (= E136), N188 (= N189), F199 (≠ L200), R202 (≠ L203), Q203 (≠ M204), K214 (≠ P215), Y216 (= Y217), R223 (= R224), N258 (= N259), R282 (= R294), H285 (= H297)
1kepA The crystal structure of dtdp-d-glucose 4,6-dehydratase (rmlb) from streptococcus suis with dtdp-xylose bound (see paper)
47% identity, 95% coverage: 1:339/355 of query aligns to 2:328/346 of 1kepA
- active site: T123 (= T134), D124 (= D135), E125 (= E136), Y159 (= Y160), K163 (= K164)
- binding nicotinamide-adenine-dinucleotide: G12 (= G11), F13 (= F12), I14 (= I13), D35 (= D33), K36 (= K34), L37 (= L35), T38 (= T36), G41 (= G39), D60 (= D59), I61 (= I60), Y80 (≠ L81), A81 (= A82), A82 (= A83), S84 (= S85), T99 (= T100), S122 (= S133), Y159 (= Y160), K163 (= K164), N189 (= N190)
- binding thymidine-5'-diphospho-beta-d-xylose: S84 (= S85), T123 (= T134), E125 (= E136), Y159 (= Y160), N188 (= N189), K198 (= K199), R223 (= R224), R282 (= R294)
P95780 dTDP-glucose 4,6-dehydratase; EC 4.2.1.46 from Streptococcus mutans serotype c (strain ATCC 700610 / UA159) (see paper)
45% identity, 95% coverage: 2:339/355 of query aligns to 5:330/348 of P95780
6bi4C 2.9 angstrom resolution crystal structure of dtdp-glucose 4,6- dehydratase (rfbb) from bacillus anthracis str. Ames in complex with NAD. (see paper)
45% identity, 95% coverage: 4:342/355 of query aligns to 4:311/311 of 6bi4C
- active site: T117 (= T134), D118 (= D135), E119 (= E136), Y142 (= Y160), K146 (= K164)
- binding beta-D-fructofuranose: Q62 (≠ C61), N63 (≠ D62), G64 (≠ R63), E65 (≠ A64)
- binding nicotinamide-adenine-dinucleotide: G8 (= G8), G11 (= G11), F12 (= F12), I13 (= I13), D34 (= D33), A35 (≠ K34), L36 (= L35), T37 (= T36), S39 (≠ A38), G40 (= G39), E60 (≠ D59), I61 (= I60), Q62 (≠ C61), F82 (≠ L81), A83 (= A82), A84 (= A83), T92 (= T100), V115 (≠ I132), T117 (= T134), Y142 (= Y160), K146 (= K164), C169 (= C187), S170 (= S188)
1r66A Crystal structure of desiv (dtdp-glucose 4,6-dehydratase) from streptomyces venezuelae with NAD and tyd bound (see paper)
46% identity, 96% coverage: 3:342/355 of query aligns to 2:322/322 of 1r66A
- active site: T127 (= T134), D128 (= D135), E129 (= E136), Y151 (= Y160), K155 (= K164)
- binding nicotinamide-adenine-dinucleotide: G10 (= G11), F11 (= F12), I12 (= I13), D37 (= D33), S38 (≠ K34), L39 (= L35), T40 (= T36), G43 (= G39), D63 (= D59), I64 (= I60), F83 (≠ L81), A84 (= A82), A85 (= A83), S87 (= S85), T102 (= T100), V125 (≠ I132), S126 (= S133), Y151 (= Y160), K155 (= K164), N181 (= N190)
- binding thymidine-5'-diphosphate: H88 (= H86), E129 (= E136), N180 (= N189), K190 (= K199), L191 (= L200), P206 (= P215), Y208 (= Y217), R215 (= R224), N250 (= N259), R274 (= R294), H277 (= H297)
6bi4B 2.9 angstrom resolution crystal structure of dtdp-glucose 4,6- dehydratase (rfbb) from bacillus anthracis str. Ames in complex with NAD. (see paper)
45% identity, 95% coverage: 4:342/355 of query aligns to 4:310/310 of 6bi4B
- active site: T117 (= T134), D118 (= D135), E119 (= E136), Y142 (= Y160), K146 (= K164)
- binding alpha-D-glucopyranose: Q62 (≠ C61), N63 (≠ D62)
- binding nicotinamide-adenine-dinucleotide: G8 (= G8), G11 (= G11), F12 (= F12), I13 (= I13), D34 (= D33), A35 (≠ K34), L36 (= L35), T37 (= T36), S39 (≠ A38), G40 (= G39), E60 (≠ D59), F82 (≠ L81), A83 (= A82), A84 (= A83), T92 (= T100), S116 (= S133), T117 (= T134), Y142 (= Y160), K146 (= K164), C169 (= C187)
1r6dA Crystal structure of desiv double mutant (dtdp-glucose 4,6- dehydratase) from streptomyces venezuelae with NAD and dau bound (see paper)
45% identity, 96% coverage: 3:342/355 of query aligns to 2:322/322 of 1r6dA
- active site: T127 (= T134), N128 (≠ D135), Q129 (≠ E136), Y151 (= Y160), K155 (= K164)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S87 (= S85), H88 (= H86), T127 (= T134), N128 (≠ D135), Q129 (≠ E136), Y151 (= Y160), N180 (= N189), K190 (= K199), L191 (= L200), P206 (= P215), Y208 (= Y217), R215 (= R224), N250 (= N259), R274 (= R294), H277 (= H297), Y281 (= Y301)
- binding nicotinamide-adenine-dinucleotide: G10 (= G11), F11 (= F12), I12 (= I13), D37 (= D33), S38 (≠ K34), L39 (= L35), T40 (= T36), A42 (= A38), G43 (= G39), D63 (= D59), I64 (= I60), F83 (≠ L81), A84 (= A82), A85 (= A83), S87 (= S85), T102 (= T100), V125 (≠ I132), S126 (= S133), Y151 (= Y160), K155 (= K164), N181 (= N190)
8sk0A Crystal structure of evds6 decarboxylase in ligand bound state (see paper)
41% identity, 96% coverage: 3:342/355 of query aligns to 8:325/329 of 8sk0A
- binding nicotinamide-adenine-dinucleotide: G16 (= G11), F17 (= F12), I18 (= I13), D43 (= D33), S44 (≠ K34), L45 (= L35), T46 (= T36), G49 (= G39), D67 (= D59), F87 (≠ L81), A88 (= A82), A89 (= A83), T91 (≠ S85), T106 (= T100), V129 (≠ I132), S130 (= S133), T131 (= T134), Y155 (= Y160), K159 (= K164)
- binding thymidine-5'-diphosphate: E133 (= E136), N184 (= N189), K194 (= K199), V195 (≠ L200), P210 (= P215), Y212 (= Y217), R219 (= R224), N254 (= N259), R278 (= R294), H281 (= H297)
8sk0B Crystal structure of evds6 decarboxylase in ligand bound state (see paper)
41% identity, 96% coverage: 3:342/355 of query aligns to 9:326/330 of 8sk0B
- binding nicotinamide-adenine-dinucleotide: G17 (= G11), F18 (= F12), I19 (= I13), D44 (= D33), S45 (≠ K34), L46 (= L35), T47 (= T36), G50 (= G39), D68 (= D59), I69 (= I60), F88 (≠ L81), A89 (= A82), A90 (= A83), T92 (≠ S85), T107 (= T100), V130 (≠ I132), Y156 (= Y160), K160 (= K164), G184 (≠ S188), N186 (= N190)
Q9SYM5 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM1; Protein REPRESSOR OF LRX1 1; Rhamnose biosynthetic enzyme 1; AtRHM1; EC 4.2.1.76; EC 1.1.1.-; EC 5.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see 3 papers)
41% identity, 96% coverage: 2:341/355 of query aligns to 7:329/669 of Q9SYM5
- R283 (= R294) mutation to K: In rol1-2; Abolishes dehydratase activity in vitro (PubMed:16766693). Induces aberrant accumulation of flavonols leading to alterations in plant growth and cell shape formation (PubMed:18567791, PubMed:18757557).
Q9LPG6 Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose-reductase RHM2; NDP-rhamnose synthase; Protein MUCILAGE-MODIFIED 4; Protein RHAMNOSE BIOSYNTHESIS 2; Rhamnose biosynthetic enzyme 2; AtRHM2; UDP-L-rhamnose synthase MUM4; EC 4.2.1.76; EC 1.1.1.-; EC 5.1.3.- from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
39% identity, 96% coverage: 2:341/355 of query aligns to 9:331/667 of Q9LPG6
- G18 (= G11) mutation to A: Abolishes dehydratase activity.
- K36 (≠ A28) mutation to A: Reduces dehydratase activity.
- D96 (= D88) mutation to N: In mum4-1; no extruded mucilage and seed coat defects. Abolishes dehydratase activity.
- K165 (= K164) mutation to A: Abolishes dehydratase activity.
- G193 (= G192) mutation to R: In mum4-2; no extruded mucilage and seed coat defects. Abolishes dehydratase activity.
Sites not aligning to the query:
- 392 G→A: No effect on dehydratase activity.
- 413 K→A: No effect on dehydratase activity.
- 518 K→A: No effect on dehydratase activity.
6vloA X-ray structure of the r141 sugar 4,6-dehydratase from acanthamoeba polyphaga minivirus (see paper)
37% identity, 94% coverage: 1:334/355 of query aligns to 3:315/319 of 6vloA
- active site: T126 (= T134), D127 (= D135), E128 (= E136), Y151 (= Y160), K155 (= K164)
- binding nicotinamide-adenine-dinucleotide: G10 (= G8), G13 (= G11), F14 (= F12), I15 (= I13), D36 (= D33), I37 (≠ K34), A42 (≠ G39), D59 (= D59), I60 (= I60), F81 (≠ L81), A82 (= A82), A83 (= A83), S85 (= S85), M124 (≠ I132), T126 (= T134), K155 (= K164)
- binding thymidine-5'-diphosphate: N180 (= N189), K190 (= K199), L191 (= L200), K194 (≠ L203), H206 (≠ P215), Q208 (≠ Y217), R215 (= R224), V250 (≠ N259), R275 (= R294), R281 (= R300)
Query Sequence
>1937129 FitnessBrowser__Keio:1937129
MRKILITGGAGFIGSALVRYIINETSDAVVVVDKLTYAGNLMSLAPVAQSERFAFEKVDI
CDRAELARVFTEHQPDCVMHLAAESHVDRSIDGPAAFIETNIVGTYTLLEAARAYWNALT
EDKKSAFRFHHISTDEVYGDLHSTDDFFTETTPYAPSSPYSASKASSDHLVRAWLRTYGL
PTLITNCSNNYGPYHFPEKLIPLMILNALAGKSLPVYGNGQQIRDWLYVEDHARALYCVA
TTGKVGETYNIGGHNERKNLDVVETICELLEELAPNKPHGVAHYRDLITFVADRPGHDLR
YAIDASKIARELGWLPQETFESGMRKTVQWYLANESWWKQVQDGSYQGERLGLKG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory