SitesBLAST
Comparing 1937170 FitnessBrowser__Keio:1937170 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
P30878 Melibiose permease; Melibiose carrier; Melibiose transporter; Melibiose/cation symporter; Na+ (Li+)/melibiose symporter; Thiomethylgalactoside permease II from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 2 papers)
26% identity, 98% coverage: 9:467/467 of query aligns to 1:468/476 of P30878
- K18 (≠ S26) mutation to C: Loss of transporter activity.
- KD 18:19 (≠ SN 26:27) binding
- D19 (≠ N27) mutation to C: Loss of transporter activity.
- R52 (≠ K60) mutation to C: Retains weak activity with Na(+), Li(+) or H(+).
- D55 (≠ T63) mutation to C: Alters cation selectivity. Retains a low level of H(+)-coupled melibiose transport, but retains only a weak activity with Na(+) or Li(+).
- N58 (≠ T66) mutation to C: Alters cation selectivity. Decreases H(+)- and Na(+)-coupled activity, with little effect on Li(+)-coupled melibiose transport.
- D59 (= D67) mutation to C: Alters cation selectivity. Retains only a low level of H(+)-coupled melibiose binding and active transport, but Na(+) or Li(+) does not stimulate either binding or transport.
- Y120 (= Y130) mutation to C: Loss of transporter activity.
- T121 (≠ S131) mutation to C: Alters cation selectivity. Inhibits H(+)- and Na(+)-coupled activity, with little effect on Li(+)-coupled melibiose transport.
- M123 (= M133) mutation to C: Does not affect transporter activity.
- D124 (≠ N134) binding ; mutation to C: Alters cation selectivity. Loss of transporter activity.
- W128 (≠ G138) binding ; mutation to C: Loss of transporter activity.
- R149 (≠ Q159) binding ; mutation to C: Retains weak activity with Na(+), Li(+) or H(+).
- K377 (= K378) mutation to C: Inhibits Na(+)- and Li(+)-coupled activity, with little effect on H(+)-coupled melibiose transport.
P02921 Melibiose permease; Melibiose carrier; Melibiose transporter; Melibiose/cation symporter; Na+ (Li+)/melibiose symporter; Thiomethylgalactoside permease II from Escherichia coli (strain K12) (see 5 papers)
26% identity, 92% coverage: 9:437/467 of query aligns to 1:436/473 of P02921
- M1 (≠ L9) modified: Initiator methionine, Removed
- K18 (≠ S26) mutation to C: Abolishes transporter activity.
- D19 (≠ N27) mutation to C: Abolishes transporter activity. Can bind Na(+). Large decrease in the affinity for melibiose in the presence of H(+).
- D35 (= D43) mutation to C: Abolishes transporter activity.
- R52 (≠ K60) mutation to C: Abolishes transporter activity.
- D55 (≠ T63) mutation to C: Abolishes transporter activity. Chemical restoration of the charge via the oxidation of the thiol to the sulfinic and/or sulfonic acid results in partial recovery of transporter activity. Does not bind Na(+). Binds melibiose in the presence of H(+).
- D59 (= D67) mutation to C: Loses ability to catalyze Na(+) or H(+)-coupled melibiose transport against a concentration gradient. Does not bind Na(+). Binds melibiose in the presence of H(+).
- D124 (≠ N134) mutation to C: Abolishes transporter activity. Chemical restoration of the charge via the oxidation of the thiol to the sulfinic and/or sulfonic acid results in partial recovery of transporter activity. Can bind Na(+), but structural changes induced by Na(+) are less complete and of smaller amplitude. Large decrease in the affinity for melibiose in the presence of H(+).
- K138 (≠ P148) mutation to C: Can transport melibiose.
- R139 (≠ N149) mutation to C: Can transport melibiose.
- R141 (= R151) mutation R->C,Q: Abolishes melibiose transport. Decreases affinity for melibiose.; mutation to K: Retains ion-coupled melibiose transport.
- R149 (≠ Q159) mutation to C: Abolishes melibiose transport.; mutation R->K,Q: Retains ion-coupled melibiose transport.
- R199 (= R207) mutation to C: Does not affect transporter activity.
- E203 (= E211) mutation to C: Does not affect transporter activity.
7l17A Crystal structure of sugar-bound melibiose permease melb (see paper)
26% identity, 92% coverage: 10:437/467 of query aligns to 1:435/453 of 7l17A
7l16A Crystal structure of sugar-bound melibiose permease melb (see paper)
26% identity, 92% coverage: 10:437/467 of query aligns to 1:435/453 of 7l16A
A6NFX1 Sphingosine-1-phosphate transporter MFSD2B; Major facilitator superfamily domain-containing protein 2B; hMfsd2b from Homo sapiens (Human) (see paper)
24% identity, 90% coverage: 10:428/467 of query aligns to 38:473/504 of A6NFX1
- D95 (= D67) mutation to A: Abolishes export of sphingosine-1-phosphate.
- T157 (≠ S131) mutation to A: Abolishes export of sphingosine-1-phosphate.
- K423 (= K378) mutation to A: Does not affect export of sphingosine-1-phosphate.
Q3T9M1 Sphingosine-1-phosphate transporter MFSD2B; Major facilitator superfamily domain-containing protein 2B; mMfsd2b from Mus musculus (Mouse) (see 2 papers)
24% identity, 80% coverage: 10:382/467 of query aligns to 28:417/494 of Q3T9M1
- D85 (= D67) mutation to A: Decreased sphingosine-1-phosphate transport.
- T147 (≠ S131) mutation to A: Decreased export of sphingosine-1-phosphate.
- K413 (= K378) mutation to A: Decreased sphingosine-1-phosphate transport.
Query Sequence
>1937170 FitnessBrowser__Keio:1937170
MSDHNPLTLKLNLREKIAYGMGDVGSNLMLCIGTLYLLKFYTDELGMPAYYGGIIFLVAK
FFTAFTDMLTGFLLDSRKNIGPKGKFRPFILYAAVPAALIATLQFIATTFCLPVKTTIAT
ALFMMFGLSYSLMNCSYGAMIPAITKNPNERAQLAAYRQGGATIGLLICTVAFIPLQSLF
SDSTVGYACAALMFSIGGFIFMMLCYRGVKEHYVDTTPTGHKASILKSFCAIFRNPPLLV
LCIANLCTLAAFNIKLAIQVYYTQYVLNDINLLSWMGFFSMGCILIGVLLVPLTVKCFGK
KQVYLAGMVLWAVGDILNYFWGSNSFTFVMFSCVAFFGTAFVNSLNWALVPDTVDYGEWK
TGIRAEGSVYTGYTFFRKISAALAGFLPGIMLTQIGYVPNIAQSDATLQGLRQLIFIWPC
ALAIIAALTMGFFYTLNEKRFALIIEEINQRKNKEMATEEKTASVTL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory