Comparing 1937256 FitnessBrowser__Keio:1937256 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
38% identity, 98% coverage: 7:497/500 of query aligns to 2:490/501 of P04983
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
31% identity, 43% coverage: 9:224/500 of query aligns to 2:215/241 of 4u00A
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 43% coverage: 8:224/500 of query aligns to 3:229/254 of 1g6hA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
31% identity, 43% coverage: 8:224/500 of query aligns to 3:229/253 of 1g9xB
3c4jA Abc protein artp in complex with atp-gamma-s
28% identity, 47% coverage: 8:244/500 of query aligns to 2:240/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
28% identity, 47% coverage: 8:244/500 of query aligns to 2:240/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
28% identity, 47% coverage: 8:244/500 of query aligns to 2:240/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
28% identity, 47% coverage: 8:244/500 of query aligns to 2:240/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
29% identity, 42% coverage: 17:224/500 of query aligns to 9:215/240 of 4ymuJ
5x40A Structure of a cbio dimer bound with amppcp (see paper)
34% identity, 47% coverage: 9:242/500 of query aligns to 4:239/280 of 5x40A
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
28% identity, 48% coverage: 7:246/500 of query aligns to 2:231/285 of 4yerA
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 41% coverage: 22:224/500 of query aligns to 18:220/343 of P30750
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 42% coverage: 14:221/500 of query aligns to 22:224/378 of P69874
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
27% identity, 43% coverage: 8:224/500 of query aligns to 1:221/344 of 6cvlD
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
27% identity, 43% coverage: 8:224/500 of query aligns to 1:221/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
27% identity, 43% coverage: 8:224/500 of query aligns to 1:221/344 of 3tuiC
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
29% identity, 43% coverage: 268:483/500 of query aligns to 10:217/240 of 6mjpA
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
31% identity, 45% coverage: 22:245/500 of query aligns to 21:238/648 of P75831
7arlD Lolcde in complex with lipoprotein and adp (see paper)
31% identity, 39% coverage: 25:221/500 of query aligns to 22:218/222 of 7arlD
7mdyC Lolcde nucleotide-bound
32% identity, 42% coverage: 25:232/500 of query aligns to 22:224/226 of 7mdyC
Sites not aligning to the query:
>1937256 FitnessBrowser__Keio:1937256
MTTDQHQEILRTEGLSKFFPGVKALDNVDFSLRRGEIMALLGENGAGKSTLIKALTGVYH
ADRGTIWLEGQAISPKNTAHAQQLGIGTVYQEVNLLPNMSVADNLFIGREPKRFGLLRRK
EMEKRATELMASYGFSLDVREPLNRFSVAMQQIVAICRAIDLSAKVLILDEPTASLDTQE
VELLFDLMRQLRDRGVSLIFVTHFLDQVYQVSDRITVLRNGSFVGCRETCELPQIELVKM
MLGRELDTHALQRAGRTLLSDKPVAAFKNYGKKGTIAPFDLEVRPGEIVGLAGLLGSGRT
ETAEVIFGIKPADSGTALIKGKPQNLRSPHQASVLGIGFCPEDRKTDGIIAAASVRENII
LALQAQRGWLRPISRKEQQEIAERFIRQLGIRTPSTEQPIEFLSGGNQQKVLLSRWLLTR
PQFLILDEPTRGIDVGAHAEIIRLIETLCADGLALLVISSELEELVGYADRVIIMRDRKQ
VAEIPLAELSVPAIMNAIAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory