Comparing 1937924_811_999 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
4qhzC Crystal structure of a putative glycosyl hydrolase (bdi_3914) from parabacteroides distasonis atcc 8503 at 2.13 a resolution
36% identity, 99% coverage: 1:188/189 of query aligns to 46:237/240 of 4qhzC
>1937924_811_999
ALFDGTAASQEQWQHTDGRKAAWPLAEERSMEVCCGDIRTKDAYQDFKLHVEFRVPLLPD
DVTGQDRGNSGIYLQDRYELQILDSYGDTTLDTNEAGAIYLKKAPDTNAATAPETWQTYD
IVFRAARFDENGAKTADARVTVVWNGETVHDDVALDGPTAAGRAETPAAGAIRLQDHGNK
VRFRDIRVE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory