Comparing 199217 FitnessBrowser__MR1:199217 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2d3tC Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form v (see paper)
67% identity, 100% coverage: 2:387/387 of query aligns to 5:390/390 of 2d3tC
8oqlC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-1
42% identity, 100% coverage: 2:387/387 of query aligns to 2:397/397 of 8oqlC
8oqmD Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-10
41% identity, 100% coverage: 2:387/387 of query aligns to 3:399/399 of 8oqmD
8oqoC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-49
41% identity, 100% coverage: 2:387/387 of query aligns to 2:398/398 of 8oqoC
8opyD Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-b-dnq
41% identity, 100% coverage: 2:387/387 of query aligns to 3:401/401 of 8opyD
7o4tD Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme with coenzyme a bound at the hydratase, thiolase active sites and possible additional binding site (coa(ech/had)) (see paper)
41% identity, 100% coverage: 2:387/387 of query aligns to 3:403/403 of 7o4tD
O53871 Putative acyltransferase Rv0859; EC 2.3.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
41% identity, 100% coverage: 2:387/387 of query aligns to 3:403/403 of O53871
8pf8C Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-72
41% identity, 100% coverage: 2:387/387 of query aligns to 2:402/402 of 8pf8C
8oqsC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-83
41% identity, 100% coverage: 2:387/387 of query aligns to 2:402/402 of 8oqsC
8oqpC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-76
41% identity, 100% coverage: 2:387/387 of query aligns to 2:402/402 of 8oqpC
4b3iC Crystal structure of mycobacterium tuberculosis fatty acid beta-oxidation complex with coenzymea bound at the hydratase active sites (see paper)
41% identity, 100% coverage: 2:387/387 of query aligns to 2:402/402 of 4b3iC
8opxC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with trehalose (fragment-b-tre)
42% identity, 100% coverage: 2:387/387 of query aligns to 2:398/398 of 8opxC
8opuC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with sulfamethoxazole (fragment-b-e1)
42% identity, 100% coverage: 2:387/387 of query aligns to 2:399/399 of 8opuC
5f38B X-ray crystal structure of a thiolase from escherichia coli at 1.8 a resolution (see paper)
44% identity, 100% coverage: 1:387/387 of query aligns to 1:391/391 of 5f38B
6pccA Crystal structure of beta-ketoadipyl-coa thiolase mutant (h356a) in complex hexanoyl coenzyme a (see paper)
42% identity, 100% coverage: 1:387/387 of query aligns to 4:403/403 of 6pccA
6pcbA Crystal structure of beta-ketoadipyl-coa thiolase mutant (h356a) in complex with coa (see paper)
42% identity, 100% coverage: 1:387/387 of query aligns to 4:403/403 of 6pcbA
5f38D X-ray crystal structure of a thiolase from escherichia coli at 1.8 a resolution (see paper)
45% identity, 100% coverage: 1:386/387 of query aligns to 3:394/394 of 5f38D
6pcdA Crystal structure of beta-ketoadipyl-coa thiolase mutant (c90s-h356a) in complex octanoyl coenzyme a (see paper)
42% identity, 100% coverage: 1:387/387 of query aligns to 5:401/401 of 6pcdA
P45359 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; CaTHL; EC 2.3.1.9 from Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) (see paper)
42% identity, 100% coverage: 1:386/387 of query aligns to 1:391/392 of P45359
4xl4A Crystal structure of thiolase from clostridium acetobutylicum in complex with coa (see paper)
42% identity, 100% coverage: 1:386/387 of query aligns to 1:391/392 of 4xl4A
>199217 FitnessBrowser__MR1:199217
MKQAVIVDCIRTPMGRSKAGVFRNVRAETLSAELMKGLLLRNPQLDPNTIEDVIWGCVQQ
TLEQGFNIARNASLLAGIPKTAGAVTVNRLCGSSMEAIHQAARAIMTGMGDTFIIGGVEH
MGHVPMNHGVDFHPGLANNVAKASGMMGLTAEMLGKLHGITREQQDAFAVRSHQRAYAAT
IEGRFAKEIYGIEGHDATGALIKVLQDEVIRPETTMESLAVLRPVFDPVNGTVTAGTSSA
LSDGASAMLIMEESKARALGLPIRARIRSMAVAGCDAAIMGYGPVPATQKALARAGITVN
DLDVIELNEAFAAQSLPCVKDLGLLDVVDEKINLNGGAIALGHPLGCSGARISTTLINLM
EHKDATLGLATMCIGLGQGIATVFERV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory