Comparing 199280 FitnessBrowser__MR1:199280 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 1 hits to proteins with known functional sites (download)
P47148 Peroxisomal protein 2 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
32% identity, 73% coverage: 9:102/128 of query aligns to 174:266/283 of P47148
Sites not aligning to the query:
>199280 FitnessBrowser__MR1:199280
MSNQRYVQGLAKLTEIDGEAGEKVIRSLADICPDLGKYIIEYPFGDIYQREGLDLKTREL
VTVAALTALGHCQPQLNVHINGALNVGCTPKEIVEVILQMSVYAGFPAALNGMFVAKTVF
SERELSAV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory