SitesBLAST
Comparing 199775 FitnessBrowser__MR1:199775 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5vg6B Crystal structure of d-isomer specific 2-hydroxyacid dehydrogenase from xanthobacter autotrophicus py2 in complex with NADPH and mes.
28% identity, 97% coverage: 9:311/311 of query aligns to 11:315/315 of 5vg6B
- active site: M98 (vs. gap), R230 (= R226), D254 (= D250), E259 (= E255), H278 (= H274)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A74 (= A68), R92 (≠ G89), M102 (= M95), L147 (≠ T143), G148 (= G144), D149 (≠ S145), L150 (≠ I146), W168 (≠ V164), S169 (≠ N165), R170 (= R166), T171 (≠ S167), K173 (≠ R169), L201 (= L197), P202 (= P198), T207 (= T203), V228 (= V224), R230 (= R226), H278 (= H274), A280 (≠ S276), S281 (≠ A277), Y315 (= Y311)
5mhaB D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with a mixture of 2-ketohexanoic acid and 2-hydroxyhexanoic acid, and NADPH (1.57 a resolution)
30% identity, 79% coverage: 61:305/311 of query aligns to 60:307/308 of 5mhaB
- binding 2-Ketohexanoic acid: R66 (≠ F67), R226 (= R226), H274 (= H274), Y282 (≠ H280)
- binding (2R)-2-hydroxyhexanoic acid: R66 (≠ F67), A67 (= A68), G68 (= G69), H91 (≠ F91), Y282 (≠ H280)
- binding magnesium ion: F212 (≠ L212), E213 (≠ A213), M215 (≠ L215), D243 (≠ P243)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A67 (= A68), G68 (= G69), T88 (≠ K88), L143 (≠ T143), G144 (= G144), T145 (≠ S145), L146 (≠ I146), R165 (≠ N165), R166 (= R166), S167 (= S167), P180 (≠ L180), T197 (≠ L197), P198 (= P198), T203 (= T203), V224 (= V224), A225 (≠ G225), R226 (= R226), H274 (= H274), S276 (= S276)
5mhaA D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with a mixture of 2-ketohexanoic acid and 2-hydroxyhexanoic acid, and NADPH (1.57 a resolution)
30% identity, 79% coverage: 61:305/311 of query aligns to 60:307/308 of 5mhaA
- binding 2-Ketohexanoic acid: R66 (≠ F67), A67 (= A68), G68 (= G69), H91 (≠ F91), R226 (= R226), H274 (= H274), Y282 (≠ H280)
- binding magnesium ion: T132 (≠ S132), A134 (≠ Q134)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A67 (= A68), G68 (= G69), T88 (≠ K88), L143 (≠ T143), G144 (= G144), T145 (≠ S145), L146 (≠ I146), R165 (≠ N165), R166 (= R166), S167 (= S167), P180 (≠ L180), T197 (≠ L197), P198 (= P198), T203 (= T203), V224 (= V224), A225 (≠ G225), R226 (= R226), H274 (= H274), S276 (= S276)
5mh5A D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with 2-keto-hexanoic acid and NADP+ (1.4 a resolution)
30% identity, 79% coverage: 61:305/311 of query aligns to 60:307/308 of 5mh5A
- binding 2-Ketohexanoic acid: R66 (≠ F67), A67 (= A68), G68 (= G69), H91 (≠ F91), R226 (= R226), H274 (= H274), Y282 (≠ H280)
- binding magnesium ion: T132 (≠ S132), A134 (≠ Q134), F212 (≠ L212), E213 (≠ A213), M215 (≠ L215), D243 (≠ P243)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A67 (= A68), G68 (= G69), T88 (≠ K88), G142 (= G142), L143 (≠ T143), G144 (= G144), T145 (≠ S145), L146 (≠ I146), R165 (≠ N165), R166 (= R166), S167 (= S167), T197 (≠ L197), P198 (= P198), T203 (= T203), V224 (= V224), A225 (≠ G225), R226 (= R226), H274 (= H274), S276 (= S276)
5mh6A D-2-hydroxyacid dehydrogenases (d2-hdh) from haloferax mediterranei in complex with 2-ketohexanoic acid and NAD+ (1.35 a resolution)
30% identity, 79% coverage: 61:305/311 of query aligns to 58:305/306 of 5mh6A
- binding 2-Ketohexanoic acid: R64 (≠ F67), A65 (= A68), G66 (= G69), H89 (≠ F91), R224 (= R226), H272 (= H274), Y280 (≠ H280)
- binding magnesium ion: T130 (≠ S132), A132 (≠ Q134), F210 (≠ L212), E211 (≠ A213), M213 (≠ L215), G225 (= G227), P226 (≠ D228), V228 (≠ L230), E230 (≠ L232), D241 (≠ P243), S251 (≠ M253)
- binding nicotinamide-adenine-dinucleotide: A65 (= A68), G66 (= G69), T86 (≠ K88), H89 (≠ F91), G142 (= G144), T143 (≠ S145), L144 (≠ I146), R164 (= R166), P196 (= P198), T201 (= T203), V222 (= V224), A223 (≠ G225), R224 (= R226), H272 (= H274), S274 (= S276)
4zqbB Crystal structure of NADP-dependent dehydrogenase from rhodobactersphaeroides in complex with NADP and sulfate
30% identity, 94% coverage: 21:311/311 of query aligns to 26:316/316 of 4zqbB
- active site: L99 (≠ F91), R231 (= R226), E260 (= E255), H279 (= H274)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R93 (≠ Q83), M103 (= M95), G147 (= G142), L148 (≠ T143), G149 (= G144), E150 (≠ S145), L151 (≠ I146), W169 (≠ V164), S170 (≠ N165), R171 (= R166), S172 (= S167), K174 (≠ R169), L202 (= L197), P203 (= P198), F229 (≠ V224), R231 (= R226), H279 (= H274), S281 (= S276), A282 (= A277), Y316 (= Y311)
4z0pA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc02828 (smghra) from sinorhizobium meliloti in complex with NADPH and oxalate (see paper)
28% identity, 94% coverage: 21:311/311 of query aligns to 20:316/316 of 4z0pA
- active site: L95 (≠ F91), R231 (= R226), G250 (≠ A241), D255 (= D250), E260 (= E255), H279 (= H274)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R89 (≠ N86), M99 (= M95), M144 (≠ T143), G145 (= G144), V146 (≠ S145), L147 (≠ I146), W165 (≠ V164), S166 (≠ N165), R167 (= R166), S168 (= S167), R170 (= R169), L197 (= L197), P198 (= P198), A229 (≠ V224), G230 (= G225), R231 (= R226), H279 (= H274), A281 (≠ S276), A282 (= A277), Y316 (= Y311)
- binding oxalic acid: W50 (= W43), G70 (≠ F67), A71 (= A68), G72 (= G69), H114 (= H110), R115 (≠ H111), R231 (= R226), H279 (= H274)
4weqA Crystal structure of NADPH-dependent glyoxylate/hydroxypyruvate reductase smc02828 (smghra) from sinorhizobium meliloti in complex with NADP and sulfate (see paper)
28% identity, 94% coverage: 21:311/311 of query aligns to 20:316/316 of 4weqA
- active site: L95 (≠ F91), R231 (= R226), G250 (≠ A241), D255 (= D250), E260 (= E255), H279 (= H274)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R89 (≠ N86), M99 (= M95), M144 (≠ T143), G145 (= G144), V146 (≠ S145), L147 (≠ I146), W165 (≠ V164), S166 (≠ N165), R167 (= R166), S168 (= S167), R170 (= R169), L197 (= L197), P198 (= P198), A229 (≠ V224), G230 (= G225), R231 (= R226), D255 (= D250), H279 (= H274), A281 (≠ S276), Y316 (= Y311)
7jqhA Structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with phosphate and NADP+
30% identity, 71% coverage: 92:311/311 of query aligns to 97:313/313 of 7jqhA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: M100 (= M95), A145 (≠ T143), G146 (= G144), V147 (≠ S145), L148 (≠ I146), W166 (≠ V164), S167 (≠ N165), R168 (= R166), T169 (≠ S167), K171 (≠ R169), L199 (= L197), P200 (= P198), L226 (≠ V224), A227 (≠ G225), R228 (= R226), D252 (= D250), H276 (= H274), A279 (= A277), Y313 (= Y311)
Sites not aligning to the query:
7jqiA Structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with alpha-ketoglutarate and NADP+
30% identity, 71% coverage: 92:311/311 of query aligns to 96:312/312 of 7jqiA
- binding 2-oxoglutaric acid: R227 (= R226), H275 (= H274)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: M99 (= M95), A144 (≠ T143), G145 (= G144), V146 (≠ S145), L147 (≠ I146), W165 (≠ V164), S166 (≠ N165), R167 (= R166), T168 (≠ S167), K170 (≠ R169), L198 (= L197), P199 (= P198), L225 (≠ V224), R227 (= R226), H275 (= H274), A278 (= A277), Y312 (= Y311)
Sites not aligning to the query:
6p35A 2.5 angstrom structure of wild type glyoxylate/hydroxypyruvate reductase a from escherichia coli in complex with 2-keto arginine and NADP
30% identity, 71% coverage: 92:311/311 of query aligns to 96:312/312 of 6p35A
- binding nadp nicotinamide-adenine-dinucleotide phosphate: M99 (= M95), A144 (≠ T143), G145 (= G144), V146 (≠ S145), L147 (≠ I146), W165 (≠ V164), S166 (≠ N165), R167 (= R166), T168 (≠ S167), K170 (≠ R169), L198 (= L197), P199 (= P198), L225 (≠ V224), R227 (= R226), H275 (= H274), A277 (≠ S276), A278 (= A277), Y312 (= Y311)
- binding 5-[(diaminomethylidene)amino]-2-oxopentanoic acid: R227 (= R226), H275 (= H274), T280 (≠ S279)
Sites not aligning to the query:
5bqfA Probable 2-hydroxyacid dehydrogenase from rhizobium etli cfn 42 in complex with NADP, hepes and l(+)-tartaric acid
28% identity, 84% coverage: 51:311/311 of query aligns to 55:317/317 of 5bqfA
- active site: E261 (= E255), H280 (= H274)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: A72 (= A68), R90 (≠ N86), M100 (= M95), G144 (= G142), L145 (≠ T143), G146 (= G144), I147 (≠ S145), L148 (≠ I146), W166 (≠ V164), S167 (≠ N165), R168 (= R166), T169 (≠ S167), L198 (= L197), P199 (= P198), A230 (≠ V224), G231 (= G225), R232 (= R226), H280 (= H274), A283 (= A277), Y317 (= Y311)
4xcvA Probable 2-hydroxyacid dehydrogenase from rhizobium etli cfn 42 in complex with NADPH
28% identity, 84% coverage: 51:311/311 of query aligns to 55:317/317 of 4xcvA
- active site: E261 (= E255), H280 (= H274)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A72 (= A68), R90 (≠ N86), M100 (= M95), G144 (= G142), L145 (≠ T143), G146 (= G144), I147 (≠ S145), L148 (≠ I146), W166 (≠ V164), S167 (≠ N165), R168 (= R166), T169 (≠ S167), K171 (≠ R169), L198 (= L197), P199 (= P198), A230 (≠ V224), G231 (= G225), R232 (= R226), H280 (= H274), A283 (= A277), Y317 (= Y311)
5tsdA Crystal structure of NADPH-dependent 2-hydroxyacid dehydrogenase from rhizobium etli cfn 42 in complex with NADPH and oxalate
28% identity, 84% coverage: 51:311/311 of query aligns to 54:316/316 of 5tsdA
- active site: E260 (= E255), H279 (= H274)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: A71 (= A68), R89 (≠ N86), M99 (= M95), G143 (= G142), L144 (≠ T143), G145 (= G144), I146 (≠ S145), L147 (≠ I146), W165 (≠ V164), S166 (≠ N165), R167 (= R166), T168 (≠ S167), K170 (≠ R169), L197 (= L197), P198 (= P198), A229 (≠ V224), G230 (= G225), R231 (= R226), D255 (= D250), H279 (= H274), Y316 (= Y311)
- binding oxalic acid: G70 (≠ F67), A71 (= A68), G72 (= G69), R231 (= R226), H279 (= H274)
Sites not aligning to the query:
3kboA 2.14 angstrom crystal structure of putative oxidoreductase (ycdw) from salmonella typhimurium in complex with NADP
28% identity, 70% coverage: 95:311/311 of query aligns to 99:312/312 of 3kboA
- active site: R227 (= R226), E256 (= E255), H275 (= H274)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: M99 (= M95), G143 (= G142), A144 (≠ T143), G145 (= G144), V146 (≠ S145), L147 (≠ I146), W165 (≠ V164), S166 (≠ N165), R167 (= R166), S168 (= S167), K170 (≠ R169), L197 (= L196), P199 (= P198), L225 (≠ V224), A226 (≠ G225), R227 (= R226), D251 (= D250), H275 (= H274), A278 (= A277), Y312 (= Y311)
Sites not aligning to the query:
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
30% identity, 77% coverage: 39:279/311 of query aligns to 43:283/304 of 1wwkA
- active site: S96 (≠ F91), R230 (= R226), D254 (= D250), E259 (= E255), H278 (= H274)
- binding nicotinamide-adenine-dinucleotide: V100 (≠ M95), G146 (= G142), F147 (≠ T143), G148 (= G144), R149 (≠ S145), I150 (= I146), Y168 (≠ V164), D169 (≠ N165), P170 (≠ R166), V201 (≠ L197), P202 (= P198), T207 (= T203), T228 (≠ V224), S229 (≠ G225), D254 (= D250), H278 (= H274), G280 (≠ S276)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
27% identity, 73% coverage: 53:279/311 of query aligns to 61:293/334 of 5aovA
- active site: L100 (≠ F91), R241 (= R226), D265 (= D250), E270 (= E255), H288 (= H274)
- binding glyoxylic acid: Y74 (≠ S66), A75 (≠ F67), V76 (≠ A68), G77 (= G69), R241 (= R226), H288 (= H274)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (≠ A68), T104 (≠ M95), F158 (≠ T143), G159 (= G144), R160 (≠ S145), I161 (= I146), S180 (≠ N165), R181 (= R166), A211 (≠ L196), V212 (≠ L197), P213 (= P198), T218 (= T203), I239 (≠ V224), A240 (≠ G225), R241 (= R226), H288 (= H274), G290 (≠ S276)
Sites not aligning to the query:
6biiA Crystal structure of pyrococcus yayanosii glyoxylate hydroxypyruvate reductase in complex with NADP and malonate (re-refinement of 5aow) (see paper)
31% identity, 56% coverage: 107:279/311 of query aligns to 119:292/332 of 6biiA
- active site: R240 (= R226), D264 (= D250), E269 (= E255), H287 (= H274)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G156 (= G142), F157 (≠ T143), G158 (= G144), R159 (≠ S145), I160 (= I146), A179 (≠ N165), R180 (= R166), S181 (= S167), K183 (≠ R169), V211 (≠ L197), P212 (= P198), E216 (= E202), T217 (= T203), V238 (= V224), A239 (≠ G225), R240 (= R226), D264 (= D250), H287 (= H274), G289 (≠ S276)
Sites not aligning to the query:
Q65CJ7 Hydroxyphenylpyruvate reductase; HPPR; EC 1.1.1.237 from Plectranthus scutellarioides (Coleus) (Solenostemon scutellarioides) (see paper)
24% identity, 82% coverage: 51:305/311 of query aligns to 59:312/313 of Q65CJ7
3bazA Structure of hydroxyphenylpyruvate reductase from coleus blumei in complex with NADP+ (see paper)
24% identity, 82% coverage: 51:305/311 of query aligns to 57:310/311 of 3bazA
- active site: L98 (≠ F91), R230 (= R226), A251 (= A247), D254 (= D250), E259 (= E255), H277 (= H274)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V74 (≠ A68), G149 (= G142), L150 (≠ T143), G151 (= G144), R152 (≠ S145), I153 (= I146), S172 (≠ N165), R173 (= R166), S174 (= S167), C201 (≠ L197), P202 (= P198), T207 (= T203), I228 (≠ V224), G229 (= G225), R230 (= R226), D254 (= D250), H277 (= H274), G279 (≠ S276)
Query Sequence
>199775 FitnessBrowser__MR1:199775
MGHKLLLLTKVNEQYRQLIEAQQLPGLELLDDNPANISQANIWLAEPKLAAPLLPHAKQL
QWLQSSFAGIDALMGPRARKDYQLTNIKGIFGPLMSEYLFGYLLAHVRGHHFYQQQQQQK
YWQVQGAMRHTSLQGMRLLILGTGSIAQHVTKTAKHFGMHVTGVNRSAREVEGFDVILPL
SQLAQALGQSDVVTNLLPSTPETRQLLNESMLAKLKADAILMNVGRGDALDLDALNAQLI
AHPAQQAILDVFMQEPLPATHPIWERTNAIITPHISAPSHPEQIVSIFCDNYRRYIAAKP
LQNQVDFTQGY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory