Comparing 199801 FitnessBrowser__MR1:199801 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P00903 Aminodeoxychorismate synthase component 2; ADC synthase; ADCS; 4-amino-4-deoxychorismate synthase component 2; Aminodeoxychorismate synthase, glutamine amidotransferase component; EC 2.6.1.85 from Escherichia coli (strain K12) (see paper)
65% identity, 98% coverage: 1:187/191 of query aligns to 1:185/187 of P00903
8hx8A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae co-crystallized with chorismate (see paper)
48% identity, 96% coverage: 3:186/191 of query aligns to 7:187/673 of 8hx8A
Sites not aligning to the query:
Q42565 Anthranilate synthase beta subunit 1, chloroplastic; Anthranilate synthase component 2-1; Anthranilate synthase, glutamine amidotransferase component 2-1; Protein TRYPTOPHAN BIOSYNTHESIS 4; Protein WEAK ETHYLENE INSENSITIVE 7; EC 4.1.3.27 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
43% identity, 97% coverage: 2:187/191 of query aligns to 75:264/276 of Q42565
1i7qB Anthranilate synthase from s. Marcescens (see paper)
42% identity, 98% coverage: 2:188/191 of query aligns to 3:187/192 of 1i7qB
P00900 Anthranilate synthase component 2; AS; ASII; Anthranilate synthase, GATase component; Anthranilate synthase, glutamine amidotransferase component; EC 4.1.3.27 from Serratia marcescens (see 3 papers)
41% identity, 98% coverage: 2:188/191 of query aligns to 4:188/193 of P00900
Sites not aligning to the query:
8hx9A Crystal structure of 4-amino-4-deoxychorismate synthase from streptomyces venezuelae with chorismate (see paper)
39% identity, 96% coverage: 3:186/191 of query aligns to 6:144/632 of 8hx9A
Sites not aligning to the query:
2ywcA Crystal structure of gmp synthetase from thermus thermophilus in complex with xmp
30% identity, 98% coverage: 1:188/191 of query aligns to 1:182/475 of 2ywcA
Sites not aligning to the query:
7yc6A Crystal structure of d110p mutant of gatase subunit of methanocaldococcus jannaschii gmp synthetase
31% identity, 98% coverage: 1:188/191 of query aligns to 1:176/183 of 7yc6A
1gpmA Escherichia coli gmp synthetase complexed with amp and pyrophosphate (see paper)
27% identity, 97% coverage: 2:187/191 of query aligns to 8:196/501 of 1gpmA
Sites not aligning to the query:
P49915 GMP synthase [glutamine-hydrolyzing]; GMP synthetase; Glutamine amidotransferase; EC 6.3.5.2 from Homo sapiens (Human) (see paper)
32% identity, 74% coverage: 47:187/191 of query aligns to 72:207/693 of P49915
Sites not aligning to the query:
2vxoB Human gmp synthetase in complex with xmp (see paper)
32% identity, 74% coverage: 47:187/191 of query aligns to 50:182/658 of 2vxoB
Sites not aligning to the query:
5tw7F Crystal structure of a gmp synthase (glutamine-hydrolyzing) from neisseria gonorrhoeae
30% identity, 81% coverage: 33:187/191 of query aligns to 36:188/490 of 5tw7F
Sites not aligning to the query:
P08955 Multifunctional protein CAD; Carbamoyl phosphate synthetase 2-aspartate transcarbamylase-dihydroorotase; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Mesocricetus auratus (Golden hamster) (see paper)
27% identity, 91% coverage: 11:183/191 of query aligns to 185:349/2225 of P08955
Sites not aligning to the query:
P07259 Multifunctional protein URA2; Pyrimidine-specific carbamoyl phosphate synthase-aspartate carbamoyl transferase; CPSase-ATCase; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
27% identity, 93% coverage: 13:190/191 of query aligns to 238:406/2214 of P07259
Sites not aligning to the query:
P0A6F1 Carbamoyl phosphate synthase small chain; Carbamoyl phosphate synthetase glutamine chain; EC 6.3.5.5 from Escherichia coli (strain K12) (see paper)
27% identity, 74% coverage: 33:173/191 of query aligns to 222:356/382 of P0A6F1
Sites not aligning to the query:
1ce8B Carbamoyl phosphate synthetase from escherichis coli with complexed with the allosteric ligand imp (see paper)
27% identity, 74% coverage: 33:173/191 of query aligns to 221:355/379 of 1ce8B
Sites not aligning to the query:
P27708 Multifunctional protein CAD; Carbamoyl phosphate synthetase 2-aspartate transcarbamylase-dihydroorotase; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Homo sapiens (Human) (see 7 papers)
26% identity, 91% coverage: 11:183/191 of query aligns to 185:349/2225 of P27708
Sites not aligning to the query:
3r75B Crystal structure of 2-amino-2-desoxyisochorismate synthase (adic) synthase phze from burkholderia lata 383 in complex with benzoate, pyruvate, glutamine and contaminating zn2+ (see paper)
27% identity, 98% coverage: 3:190/191 of query aligns to 434:617/622 of 3r75B
Sites not aligning to the query:
1c3oB Crystal structure of the carbamoyl phosphate synthetase: small subunit mutant c269s with bound glutamine (see paper)
27% identity, 74% coverage: 33:173/191 of query aligns to 221:355/379 of 1c3oB
Sites not aligning to the query:
Q18990 Multifunctional protein pyr-1; EC 6.3.5.5; EC 3.5.1.2; EC 6.3.4.16; EC 2.1.3.2; EC 3.5.2.3 from Caenorhabditis elegans (see 3 papers)
27% identity, 75% coverage: 47:190/191 of query aligns to 221:359/2198 of Q18990
Sites not aligning to the query:
>199801 FitnessBrowser__MR1:199801
MLLMIDNYDSFTFNLVQYFQQLGQEIVVKRNDEISLEGIEALAPSHLVISPGPCSPNEAG
ISLAAIEHFATRLPILGVCLGHQAMAQVFGAKVVRAQRVMHGKVSAIAHTGERLFKGLNQ
PLTVTRYHSLLVDTVPKDFVLDAWFDDPTHGREIMAMSHKELPLFGVQFHPESILTEQGH
ELLANFLSQST
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory