SitesBLAST
Comparing 199807 SO0619 succinylglutamic semialdehyde dehydrogenase (NCBI ptt file) to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5u0mA Fatty aldehyde dehydrogenase from marinobacter aquaeolei vt8 and cofactor complex (see paper)
61% identity, 99% coverage: 4:486/487 of query aligns to 7:488/488 of 5u0mA
- active site: N148 (= N145), K171 (= K168), E246 (= E243), C280 (= C277), E377 (= E375), P455 (≠ A453)
- binding nicotinamide-adenine-dinucleotide: F144 (= F141), Y147 (= Y144), N148 (= N145), K171 (= K168), S173 (= S170), E174 (= E171), G207 (= G204), T222 (= T219), G223 (= G220), S224 (= S221), V227 (≠ T224), E246 (= E243), M247 (= M244), G248 (= G245), C280 (= C277), E377 (= E375), F379 (= F377)
5u0lA X-ray crystal structure of fatty aldehyde dehydrogenase enzymes from marinobacter aquaeolei vt8 complexed with a substrate (see paper)
61% identity, 99% coverage: 4:486/487 of query aligns to 7:488/488 of 5u0lA
- active site: N148 (= N145), K171 (= K168), E246 (= E243), C280 (= C277), E377 (= E375), P455 (≠ A453)
- binding decanal: K107 (= K104), H152 (= H149), L153 (= L150), G156 (= G153), H157 (= H154), S456 (= S454), A457 (= A455)
3ju8A Crystal structure of succinylglutamic semialdehyde dehydrogenase from pseudomonas aeruginosa.
61% identity, 99% coverage: 2:484/487 of query aligns to 4:486/486 of 3ju8A
- active site: N147 (= N145), K170 (= K168), E245 (= E243), C279 (= C277), E377 (= E375), P455 (≠ A453)
- binding nicotinamide-adenine-dinucleotide: G144 (= G142), Y146 (= Y144), N147 (= N145), L152 (= L150), K170 (= K168), S172 (= S170), F220 (= F218), T221 (= T219), G222 (= G220), S223 (= S221), T226 (= T224), E245 (= E243), M246 (= M244), G247 (= G245), C279 (= C277), E377 (= E375), F379 (= F377), F444 (= F442)
5izdA Wild-type glyceraldehyde dehydrogenase from thermoplasma acidophilum in complex with NADP
31% identity, 83% coverage: 4:408/487 of query aligns to 6:414/494 of 5izdA
- active site: N149 (= N145), K172 (= K168), E247 (= E243), C281 (= C277), E381 (= E375)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L145 (≠ F141), T146 (≠ G142), W148 (≠ Y144), K172 (= K168), P173 (= P169), S174 (= S170), S175 (≠ E171), R204 (≠ E200), G205 (vs. gap), G209 (= G204), D210 (≠ K205), G225 (= G220), S226 (= S221), T229 (= T224)
Sites not aligning to the query:
P25526 Succinate-semialdehyde dehydrogenase [NADP(+)] GabD; SSDH; Glutarate-semialdehyde dehydrogenase; EC 1.2.1.79; EC 1.2.1.- from Escherichia coli (strain K12) (see paper)
33% identity, 94% coverage: 4:461/487 of query aligns to 14:472/482 of P25526
3jz4A Crystal structure of e. Coli NADP dependent enzyme (see paper)
33% identity, 94% coverage: 4:461/487 of query aligns to 13:471/481 of 3jz4A
- active site: N156 (= N145), K179 (= K168), E254 (= E243), C288 (= C277), E385 (= E375), E462 (≠ A453)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: P154 (= P143), W155 (≠ Y144), K179 (= K168), A181 (≠ S170), S182 (≠ E171), A212 (≠ V201), G216 (= G204), G232 (= G220), S233 (= S221), I236 (≠ T224), C288 (= C277), K338 (≠ G329), E385 (= E375), F387 (= F377)
6wsbA Crystal structure of a betaine aldehyde dehydrogenase from burkholderia pseudomallei bound to cofactor NAD (see paper)
31% identity, 91% coverage: 11:452/487 of query aligns to 19:461/489 of 6wsbA
- active site: N152 (= N145), E250 (= E243), C284 (= C277)
- binding nicotinamide-adenine-dinucleotide: I148 (≠ F141), G149 (= G142), A150 (≠ P143), W151 (≠ Y144), N152 (= N145), K175 (= K168), E178 (= E171), G208 (≠ V201), G211 (= G204), A212 (≠ K205), F225 (= F218), T226 (= T219), G227 (= G220), G228 (≠ S221), T231 (= T224), V235 (≠ L228), E250 (= E243), L251 (≠ M244), G252 (= G245), C284 (= C277), E385 (= E375), F387 (= F377)
Sites not aligning to the query:
Q56YU0 Aldehyde dehydrogenase family 2 member C4; ALDH1a; Protein REDUCED EPIDERMAL FLUORESCENCE 1; EC 1.2.1.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
32% identity, 94% coverage: 4:460/487 of query aligns to 23:483/501 of Q56YU0
- G152 (= G126) mutation to E: In ref1-7; reduced activity on sinapaldehyde.
- G416 (≠ A392) mutation to R: In ref1-6; reduced activity on sinapaldehyde.
6tgwA Crystal structure of human aldehyde dehydrogenase 1a3 in complex with a selective inhibitor (see paper)
30% identity, 96% coverage: 4:470/487 of query aligns to 9:477/478 of 6tgwA
- active site: N155 (= N145), E254 (= E243), C288 (= C277), E459 (≠ A453)
- binding methyl 5-(1,3-benzodioxol-5-yl)-2-phenyl-pyrazolo[1,5-a]pyrimidine-7-carboxylate: I106 (≠ T96), G110 (≠ A100), F156 (= F146), Q278 (= Q267), F282 (≠ I271), L442 (≠ A436), A444 (≠ G438)
- binding nicotinamide-adenine-dinucleotide: I151 (≠ F141), T152 (≠ G142), P153 (= P143), W154 (≠ Y144), K178 (= K168), G211 (≠ V201), G215 (= G204), F229 (= F218), G231 (= G220), S232 (= S221), V235 (≠ T224)
7a6qB Crystal structure of human aldehyde dehydrogenase 1a3 in complex with selective nr6 inhibitor compound (see paper)
30% identity, 96% coverage: 4:470/487 of query aligns to 17:488/489 of 7a6qB
- active site: N163 (= N145), E262 (= E243), C296 (= C277), E470 (≠ A453)
- binding nicotinamide-adenine-dinucleotide: I159 (≠ F141), W162 (≠ Y144), K186 (= K168), E189 (= E171), G219 (≠ V201), G223 (= G204), S240 (= S221), V243 (≠ T224), K342 (≠ A325)
- binding (3-oxidanylidene-3-sodiooxy-propanoyl)oxysodium: A32 (= A18), T33 (≠ S19), C34 (≠ S20), P36 (= P22), D103 (≠ E86), E189 (= E171), Q190 (≠ L172), F218 (≠ E200), I339 (= I322), D340 (≠ S323)
- binding 3-(2-phenylimidazo[1,2-a]pyridin-6-yl)benzenecarbonitrile: G118 (≠ A100), D141 (≠ T123), N143 (≠ A125), N451 (≠ T434), L453 (≠ A436), A455 (≠ G438)
7a6qA Crystal structure of human aldehyde dehydrogenase 1a3 in complex with selective nr6 inhibitor compound (see paper)
30% identity, 96% coverage: 4:470/487 of query aligns to 17:488/489 of 7a6qA
- active site: N163 (= N145), E262 (= E243), C296 (= C277), E470 (≠ A453)
- binding nicotinamide-adenine-dinucleotide: I159 (≠ F141), T160 (≠ G142), W162 (≠ Y144), K186 (= K168), A188 (≠ S170), E189 (= E171), G219 (≠ V201), G223 (= G204), S240 (= S221), V243 (≠ T224), K342 (≠ A325), K346 (≠ G329)
- binding 3-(2-phenylimidazo[1,2-a]pyridin-6-yl)benzenecarbonitrile: G118 (≠ A100), D141 (≠ T123), N143 (≠ A125), N451 (≠ T434), L453 (≠ A436), Y454 (≠ S437)
5fhzA Human aldehyde dehydrogenase 1a3 complexed with NAD(+) and retinoic acid (see paper)
30% identity, 96% coverage: 4:470/487 of query aligns to 17:488/489 of 5fhzA
- active site: N163 (= N145), K186 (= K168), E262 (= E243), C296 (= C277), E393 (= E375), E470 (≠ A453)
- binding nicotinamide-adenine-dinucleotide: I159 (≠ F141), T160 (≠ G142), W162 (≠ Y144), K186 (= K168), E189 (= E171), G219 (≠ V201), G223 (= G204), F237 (= F218), G239 (= G220), S240 (= S221), T241 (≠ S222), V243 (≠ T224), G264 (= G245), Q343 (≠ A326), E393 (= E375)
- binding retinoic acid: G118 (≠ A100), R121 (≠ G103), F164 (= F146), M168 (≠ L150), W171 (≠ G153), C295 (≠ R276), C296 (= C277), L453 (≠ A436)
P47895 Retinaldehyde dehydrogenase 3; RALDH-3; RalDH3; Aldehyde dehydrogenase 6; Aldehyde dehydrogenase family 1 member A3; ALDH1A3; EC 1.2.1.36 from Homo sapiens (Human) (see 2 papers)
30% identity, 96% coverage: 4:470/487 of query aligns to 35:506/512 of P47895
- R89 (≠ F54) to C: in MCOP8; does not affect ALDH1A3 expression; results in strongly reduced protein levels; dbSNP:rs397514652
- K204 (= K168) binding
- E207 (= E171) binding
- GSTEVG 257:262 (≠ GSSRTG 220:225) binding
- Q361 (≠ A326) binding
- E411 (= E375) binding
- A493 (= A458) to P: in MCOP8; does not affect ALDH1A3 expression; results in strongly reduced protein levels; dbSNP:rs397514653
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
7qk9A Crystal structure of the aldh1a3-atp complex (see paper)
30% identity, 96% coverage: 4:470/487 of query aligns to 16:487/489 of 7qk9A
- binding adenosine-5'-triphosphate: I158 (≠ F141), T159 (≠ G142), P160 (= P143), W161 (≠ Y144), K185 (= K168), E188 (= E171), G218 (≠ V201), G222 (= G204), F236 (= F218), S239 (= S221), V242 (≠ T224)
6tryA Crystal structure of human aldehyde dehydrogenase 1a3 in complex with mf13 inhibitor compound (see paper)
30% identity, 96% coverage: 4:470/487 of query aligns to 10:476/478 of 6tryA
- active site: N156 (= N145), E255 (= E243), C289 (= C277), E458 (≠ A453)
- binding nicotinamide-adenine-dinucleotide: I152 (≠ F141), T153 (≠ G142), W155 (≠ Y144), K179 (= K168), A181 (≠ S170), E182 (= E171), G212 (≠ V201), G216 (= G204), A217 (≠ K205), F230 (= F218), G232 (= G220), S233 (= S221), V236 (≠ T224), K335 (≠ A325)
- binding 8-(4-chlorophenyl)-2-phenyl-imidazo[1,2-a]pyridine: I107 (≠ T96), G111 (≠ A100), T115 (≠ K104), L160 (≠ H149), C288 (≠ R276), L441 (≠ A436), A443 (≠ G438)
6te5B Crystal structure of human aldehyde dehydrogenase 1a3 in complex with lq43 inhibitor compound (see paper)
30% identity, 96% coverage: 4:470/487 of query aligns to 11:477/479 of 6te5B
- active site: N157 (= N145), E256 (= E243), C290 (= C277), E459 (≠ A453)
- binding 6-(3,5-dimethoxyphenyl)-2-(4-methoxyphenyl)imidazo[1,2-a]pyridine: E111 (≠ A99), G112 (≠ A100), T116 (≠ K104), L442 (≠ A436), A444 (≠ G438)
- binding nicotinamide-adenine-dinucleotide: I153 (≠ F141), T154 (≠ G142), W156 (≠ Y144), K180 (= K168), E183 (= E171), G213 (≠ V201), F231 (= F218), S234 (= S221), V237 (≠ T224), Q337 (≠ A326), K340 (≠ G329)
6rttA Piperideine-6-carboxylate dehydrogenase from streptomyces clavuligerus complexed with picolinic acid (see paper)
32% identity, 91% coverage: 13:454/487 of query aligns to 28:477/508 of 6rttA
- active site: N161 (= N145), E262 (= E243), C296 (= C277), E476 (≠ A453)
- binding pyridine-2-carboxylic acid: A159 (≠ P143), F162 (= F146), V166 (≠ L150), W169 (≠ G153), G240 (= G220), S241 (= S221), R295 (= R276), C296 (= C277), T297 (= T278), E396 (= E375), F398 (= F377), P421 (≠ R400), K469 (≠ G446), E470 (≠ A447)
6rtsA Piperideine-6-carboxylate dehydrogenase from streptomyces clavuligerus complexed with NAD+ (see paper)
32% identity, 91% coverage: 13:454/487 of query aligns to 29:478/509 of 6rtsA
- active site: N162 (= N145), E263 (= E243), C297 (= C277), E477 (≠ A453)
- binding nicotinamide-adenine-dinucleotide: I158 (≠ F141), S159 (≠ G142), A160 (≠ P143), F161 (≠ Y144), N162 (= N145), K185 (= K168), S187 (= S170), E188 (= E171), A222 (≠ V201), G225 (= G204), T240 (= T219), G241 (= G220), S242 (= S221), M245 (≠ T224), E263 (= E243), L264 (≠ M244), C297 (= C277), E397 (= E375), F399 (= F377)
Q9HTJ1 NAD/NADP-dependent betaine aldehyde dehydrogenase; BADH; EC 1.2.1.8 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 2 papers)
30% identity, 92% coverage: 4:452/487 of query aligns to 10:463/490 of Q9HTJ1
- GAWN 150:153 (≠ GPYN 142:145) binding
- K162 (≠ H154) active site, Charge relay system
- KPSE 176:179 (= KPSE 168:171) binding
- G209 (vs. gap) binding
- GTST 230:233 (≠ SSRT 221:224) binding
- E252 (= E243) active site, Proton acceptor
- C286 (= C277) binding covalent; modified: Cysteine sulfenic acid (-SOH)
- E387 (= E375) binding
Sites not aligning to the query:
- 464 active site, Charge relay system
4cazA Crystal structure of betaine aldehyde dehydrogenase from pseudomonas aeruginosa in complex with nadh
30% identity, 92% coverage: 4:452/487 of query aligns to 9:462/489 of 4cazA
- active site: N152 (= N145), K175 (= K168), E251 (= E243), C285 (= C277), E386 (= E375)
- binding [[(2R,3S,4R,5R)-5-[(3R)-3-aminocarbonyl-3,4-dihydro-2H-pyridin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanidyl-phosphoryl] [(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl phosphate: I148 (≠ F141), G149 (= G142), W151 (≠ Y144), N152 (= N145), K175 (= K168), E178 (= E171), G208 (vs. gap), G212 (= G204), F226 (= F218), T227 (= T219), G228 (= G220), G229 (≠ S221), T232 (= T224), V236 (≠ L228), E251 (= E243), L252 (≠ M244), C285 (= C277), E386 (= E375), F388 (= F377)
Sites not aligning to the query:
Query Sequence
>199807 SO0619 succinylglutamic semialdehyde dehydrogenase (NCBI ptt file)
MTHFIKGQWHTGKGHDVASSNPANGEIIWRGQTATAEQVNAAVDAAREAQFDWFILGFDA
RLKIVEAYRSQLEANKAELAETIAQETGKPQWETATEVAAMIGKIGLSASAYNKRTGTET
NDTPAGRAVLRHKPHGVVAVFGPYNFPGHLPNGHIVPALLAGNSVVFKPSELTPKVAELM
VTLWEKSGLPAGVLNLVQGEVDTGKALASHPQLDGLFFTGSSRTGHLLHQQYAGHPGKIL
ALEMGGNNPLIIKGVADIKAAVHDILQSAYISSGQRCTCARRLYVEQGEQGDALVAKLVE
AVKQIKVGPWNAQPQPFMGSMISEAAAKGMVAAQANLLSLGGVPLVELMHLQAGTGLVSP
GLIDVTAVSELPDEEYFGPLLQLVRYSDFDQAIKLANQTRYGLSAGILADSREDYEYFLA
RIRAGIVNWNKQITGASGAAPFGGVGASGNHRASAFYAADYCAYPVASVEADAVSLPATL
SPGLTLS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory