SitesBLAST
Comparing 199882 FitnessBrowser__MR1:199882 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A6T3 Galactokinase; Galactose kinase; EC 2.7.1.6 from Escherichia coli (strain K12) (see 2 papers)
42% identity, 98% coverage: 6:378/381 of query aligns to 5:381/382 of P0A6T3
- Y371 (= Y368) mutation to H: Displays relaxed substrate specificity since it gains kinase activity toward sugars as diverse as D-galacturonic acid, D-talose, L-altrose, and L-glucose. Also shows enhanced turnover of the small pool of sugars converted by the wild-type enzyme.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
6q8zA Structure of human galactokinase 1 bound with n-(cyclobutylmethyl)-1, 5-dimethyl-1h-pyrazole-4-carboxamide
35% identity, 97% coverage: 8:376/381 of query aligns to 16:387/392 of 6q8zA
- binding beta-D-galactopyranose: E43 (= E35), H44 (≠ Y36), D46 (= D38), Y47 (= Y39), G183 (≠ S172), M185 (= M174), D186 (= D175), Y236 (≠ S224), G345 (vs. gap), G346 (vs. gap)
- binding 2-(1,3-benzoxazol-2-ylamino)spiro[1,6,7,8-tetrahydroquinazoline-4,1'-cyclohexane]-5-one: R105 (≠ G92), Y109 (= Y96), V129 (= V118), L135 (= L124), G136 (≠ A125), S141 (= S130), S142 (= S131)
- binding ~{N}-(cyclobutylmethyl)-1,5-dimethyl-pyrazole-4-carboxamide: A31 (≠ L23), V32 (≠ Y24), S33 (≠ Q25)
Sites not aligning to the query:
6q91A Structure of human galactokinase 1 bound with 5-chloro-n-isobutyl-2- methoxybenzamide
35% identity, 97% coverage: 8:376/381 of query aligns to 16:387/392 of 6q91A
- binding beta-D-galactopyranose: E43 (= E35), H44 (≠ Y36), D46 (= D38), Y47 (= Y39), C182 (= C171), G183 (≠ S172), M185 (= M174), D186 (= D175), Y236 (≠ S224), G346 (vs. gap)
- binding 2-(1,3-benzoxazol-2-ylamino)spiro[1,6,7,8-tetrahydroquinazoline-4,1'-cyclohexane]-5-one: R105 (≠ G92), W106 (= W93), Y109 (= Y96), S131 (≠ G120), L135 (= L124), G136 (≠ A125), S141 (= S130)
- binding 5-chloranyl-2-methoxy-~{N}-(2-methylpropyl)benzamide: L213 (≠ I202), S214 (≠ P203), D215 (≠ E204), L218 (= L206), L295 (= L283), G298 (≠ N286), D299 (≠ N287), Y300 (≠ I288), F303 (= F291), L355 (= L340)
7s4cA Crystal structure of inhibitor-bound galactokinase (see paper)
35% identity, 97% coverage: 8:376/381 of query aligns to 15:386/391 of 7s4cA
- binding alpha-D-galactopyranose: E42 (= E35), H43 (≠ Y36), D45 (= D38), Y46 (= Y39), G182 (≠ S172), D185 (= D175), Y235 (≠ S224), G345 (vs. gap)
- binding phosphate ion: G135 (≠ A125), G137 (= G127), S139 (= S129), S140 (= S130), S141 (= S131), Q171 (≠ R161), H174 (≠ Y164), H362 (≠ A348), H366 (≠ A352), E369 (= E359)
- binding 2-({(4R)-4-(2-chlorophenyl)-2-[(6-fluoro-1,3-benzoxazol-2-yl)amino]-6-methyl-1,4-dihydropyrimidine-5-carbonyl}amino)pyridine-4-carboxylic acid: M54 (≠ A47), D82 (vs. gap), R104 (≠ G92), W105 (= W93), Y108 (= Y96), L134 (= L124), S140 (= S130), L144 (= L134), K194 (≠ P184), L212 (≠ I202), D214 (≠ E204), L217 (= L206), A218 (≠ S207), V219 (≠ L208), L294 (= L283), F302 (= F291), L354 (= L340), S380 (≠ C370), Q381 (≠ S371), A382 (= A372)
7s49A Crystal structure of inhibitor-bound galactokinase (see paper)
35% identity, 97% coverage: 8:376/381 of query aligns to 15:386/391 of 7s49A
- binding (4R)-2-[(1,3-benzoxazol-2-yl)amino]-4-(4-chloro-1H-pyrazol-5-yl)-4,6,7,8-tetrahydroquinazolin-5(1H)-one: S78 (≠ A71), D82 (vs. gap), R104 (≠ G92), W105 (= W93), Y108 (= Y96), V128 (= V118), L134 (= L124), S140 (= S130), S141 (= S131), L144 (= L134), R227 (≠ E216)
- binding alpha-D-galactopyranose: E42 (= E35), H43 (≠ Y36), D45 (= D38), Y46 (= Y39), G182 (≠ S172), D185 (= D175), Y235 (≠ S224)
- binding phosphate ion: G135 (≠ A125), G137 (= G127), S139 (= S129), S140 (= S130), S141 (= S131), Q171 (≠ R161), H174 (≠ Y164), H362 (≠ A348), H366 (≠ A352)
7rclA Crystal structure of adp-bound galactokinase (see paper)
35% identity, 97% coverage: 8:376/381 of query aligns to 15:386/391 of 7rclA
- binding adenosine-5'-diphosphate: T76 (≠ A69), S78 (≠ A71), W105 (= W93), Y108 (= Y96), G135 (≠ A125), G137 (= G127), S139 (= S129), S140 (= S130), S141 (= S131), L144 (= L134), H228 (≠ K217)
- binding alpha-D-galactopyranose: E42 (= E35), H43 (≠ Y36), D45 (= D38), Y46 (= Y39), C181 (= C171), G182 (≠ S172), M184 (= M174), D185 (= D175), Y235 (≠ S224)
- binding phosphate ion: H362 (≠ A348), H366 (≠ A352)
7ozxB Structure of human galactokinase 1 bound with azepan-1-yl(2,6- difluorophenyl)methanone
35% identity, 97% coverage: 8:376/381 of query aligns to 15:386/391 of 7ozxB
- binding beta-D-galactopyranose: E42 (= E35), H43 (≠ Y36), D45 (= D38), Y46 (= Y39), G182 (≠ S172), M184 (= M174), D185 (= D175), Y235 (≠ S224), G345 (vs. gap)
- binding 2-(1,3-benzoxazol-2-ylamino)spiro[1,6,7,8-tetrahydroquinazoline-4,1'-cyclohexane]-5-one: S78 (≠ A71), D82 (vs. gap), R104 (≠ G92), Y108 (= Y96), S130 (≠ G120), L134 (= L124), S140 (= S130), S141 (= S131), L144 (= L134)
- binding (azepan-1-yl)(2,6-difluorophenyl)methanone: S32 (≠ Q25)
Sites not aligning to the query:
6zgyA Structure of human galactokinase 1 bound with 2-(4-chlorophenyl)-n- (pyrimidin-2-yl)acetamide (see paper)
35% identity, 97% coverage: 8:376/381 of query aligns to 15:386/391 of 6zgyA
- binding beta-D-galactopyranose: E42 (= E35), H43 (≠ Y36), D45 (= D38), Y46 (= Y39), G182 (≠ S172), M184 (= M174), D185 (= D175), Y235 (≠ S224)
- binding 2-(1,3-benzoxazol-2-ylamino)spiro[1,6,7,8-tetrahydroquinazoline-4,1'-cyclohexane]-5-one: D82 (vs. gap), R104 (≠ G92), W105 (= W93), V128 (= V118), S130 (≠ G120), L134 (= L124), S140 (= S130), L144 (= L134)
- binding (2,5-dimethylphenyl) pyridine-4-carboxylate: L212 (≠ I202), D214 (≠ E204), L217 (= L206), L294 (= L283), F302 (= F291), L354 (= L340)
6qjeA Structure of human galactokinase 1 bound with 4-{[2-(methylsulfonyl)- 1h-imidazol-1-yl]methyl}-1,3-thiazole
35% identity, 97% coverage: 8:376/381 of query aligns to 14:385/390 of 6qjeA
- binding beta-D-galactopyranose: E41 (= E35), H42 (≠ Y36), D44 (= D38), Y45 (= Y39), G181 (≠ S172), M183 (= M174), D184 (= D175), Y234 (≠ S224), G344 (vs. gap)
- binding 2-(1,3-benzoxazol-2-ylamino)spiro[1,6,7,8-tetrahydroquinazoline-4,1'-cyclohexane]-5-one: S77 (≠ A71), Y107 (= Y96), V127 (= V118), S129 (≠ G120), L133 (= L124), S139 (= S130), S140 (= S131), R226 (≠ E216)
- binding 4-[(2-methylsulfonylimidazol-1-yl)methyl]-1,3-thiazole: R103 (≠ G92), A176 (≠ V167), G177 (≠ A168)
6q3xA Structure of human galactokinase in complex with galactose and 2'- (benzo[d]oxazol-2-ylamino)-7',8'-dihydro-1'h-spiro[cyclohexane-1,4'- quinazolin]-5'(6'h)-one (see paper)
35% identity, 97% coverage: 8:376/381 of query aligns to 17:388/393 of 6q3xA
- binding beta-D-galactopyranose: E44 (= E35), H45 (≠ Y36), D47 (= D38), G184 (≠ S172), M186 (= M174), D187 (= D175), Y237 (≠ S224), G347 (vs. gap)
- binding 2-(1,3-benzoxazol-2-ylamino)spiro[1,6,7,8-tetrahydroquinazoline-4,1'-cyclohexane]-5-one: Y110 (= Y96), L136 (= L124), S142 (= S130), S143 (= S131), L146 (= L134)
6zh0A Structure of human galactokinase 1 bound with 2-(4-chlorophenyl)-n- (pyrimidin-2-yl)acetamide (see paper)
35% identity, 97% coverage: 8:376/381 of query aligns to 15:385/390 of 6zh0A
- binding beta-D-galactopyranose: R36 (= R29), E42 (= E35), H43 (≠ Y36), D45 (= D38), G182 (≠ S172), M184 (= M174), D185 (= D175), Y235 (≠ S224), G345 (vs. gap)
- binding 2-(1,3-benzoxazol-2-ylamino)spiro[1,6,7,8-tetrahydroquinazoline-4,1'-cyclohexane]-5-one: D82 (vs. gap), R104 (≠ G92), W105 (= W93), L134 (= L124), S140 (= S130), L144 (= L134)
- binding N-(3-chlorophenyl)-2,2,2-trifluoroacetamide: L212 (≠ I202), L294 (= L283), G297 (≠ N286), D298 (≠ N287), Y299 (≠ I288), F302 (= F291), L354 (= L340)
6zfhA Structure of human galactokinase in complex with galactose and 2'- (benzo[d]oxazol-2-ylamino)-7',8'-dihydro-1'h-spiro[cyclopentane-1,4'- quinazolin]-5'(6'h)-one (see paper)
35% identity, 97% coverage: 8:376/381 of query aligns to 14:381/386 of 6zfhA
- binding beta-D-galactopyranose: E41 (= E35), H42 (≠ Y36), D44 (= D38), G181 (≠ S172), M183 (= M174), D184 (= D175), Y230 (≠ L220), G340 (vs. gap)
- binding 2-(1,3-benzoxazol-2-ylamino)spiro[1,6,7,8-tetrahydroquinazoline-4,1'-cyclopentane]-5-one: W104 (= W93), Y107 (= Y96), L133 (= L124), S139 (= S130), S140 (= S131), L143 (= L134)
1wuuA Crystal structure of human galactokinase complexed with mgamppnp and galactose (see paper)
35% identity, 97% coverage: 8:376/381 of query aligns to 17:386/391 of 1wuuA
- binding phosphoaminophosphonic acid-adenylate ester: T78 (≠ A69), S80 (≠ A71), W107 (= W93), Y110 (= Y96), L136 (= L124), G137 (≠ A125), G139 (= G127), S141 (= S129), S142 (= S130), S143 (= S131), L146 (= L134)
- binding alpha-D-galactopyranose: E44 (= E35), H45 (≠ Y36), D47 (= D38), Y48 (= Y39), G184 (≠ S172), M186 (= M174), D187 (= D175), Y235 (≠ S224)
6gr2A Structure of human galactokinase in complex with galactose and adp
35% identity, 97% coverage: 8:376/381 of query aligns to 13:378/383 of 6gr2A
- binding adenosine-5'-diphosphate: T74 (≠ A69), S76 (≠ A71), Y106 (= Y96), L132 (= L124), G133 (≠ A125), G135 (= G127), S137 (= S129), S138 (= S130), S139 (= S131)
- binding beta-D-galactopyranose: E40 (= E35), H41 (≠ Y36), D43 (= D38), G180 (≠ S172), D183 (= D175), Y227 (≠ Q218)
6q3wC Structure of human galactokinase 1 bound with ethyl 1-(2-pyrazinyl)-4- piperidinecarboxylate
35% identity, 97% coverage: 8:376/381 of query aligns to 15:385/390 of 6q3wC
- binding beta-D-galactopyranose: E42 (= E35), H43 (≠ Y36), D45 (= D38), Y46 (= Y39), G182 (≠ S172), M184 (= M174), D185 (= D175), Y235 (≠ S224), G344 (vs. gap)
- binding 2-(1,3-benzoxazol-2-ylamino)spiro[1,6,7,8-tetrahydroquinazoline-4,1'-cyclohexane]-5-one: D82 (vs. gap), R104 (≠ G92), W105 (= W93), Y108 (= Y96), V128 (= V118), S130 (≠ G120), L134 (= L124), S140 (= S130), S141 (= S131), R227 (≠ E216)
- binding ethyl 1-pyrazin-2-ylpiperidine-4-carboxylate: R104 (≠ G92), N107 (= N95), Y108 (= Y96), A177 (≠ V167), G178 (≠ A168)
6q90C Structure of human galactokinase 1 bound with 1-(4-methoxyphenyl)-3- (4-pyridinyl)urea
35% identity, 97% coverage: 8:376/381 of query aligns to 16:386/391 of 6q90C
- binding beta-D-galactopyranose: E43 (= E35), H44 (≠ Y36), D46 (= D38), Y47 (= Y39), G182 (≠ S172), D185 (= D175)
- binding 2-(1,3-benzoxazol-2-ylamino)spiro[1,6,7,8-tetrahydroquinazoline-4,1'-cyclohexane]-5-one: R104 (≠ G92), W105 (= W93), Y108 (= Y96), L134 (= L124), S140 (= S130), L144 (= L134)
- binding N-(4-methoxyphenyl)-N'-pyridin-4-ylurea: L212 (≠ I202), D214 (≠ E204), P215 (vs. gap), L217 (= L206), L354 (= L340), Q381 (≠ S371)
6zgvD Structure of human galactokinase 1 bound with 2-(4-chlorophenyl)-n- (pyrimidin-2-yl)acetamide (see paper)
35% identity, 97% coverage: 8:376/381 of query aligns to 9:367/372 of 6zgvD
Q9R7D7 Galactokinase; Galactose kinase; EC 2.7.1.6 from Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis) (see paper)
34% identity, 98% coverage: 9:380/381 of query aligns to 15:397/399 of Q9R7D7
6zgwD Structure of human galactokinase 1 bound with (4-chlorophenyl)methyl pyridine-3-carboxylate (see paper)
35% identity, 92% coverage: 26:376/381 of query aligns to 26:366/371 of 6zgwD
1pieA Crystal structure of lactococcus lactis galactokinase complexed with galactose (see paper)
34% identity, 97% coverage: 9:379/381 of query aligns to 7:388/388 of 1pieA
- binding alpha-D-galactopyranose: E34 (= E35), H35 (≠ Y36), D37 (= D38), Y38 (= Y39), S171 (≠ C171), D175 (= D175), Y225 (vs. gap), A340 (vs. gap)
- binding phosphate ion: R28 (= R29), G127 (= G127), S129 (= S129), D175 (= D175)
Query Sequence
>199882 FitnessBrowser__MR1:199882
MSNPAQRATKLFVQTFGTKADDLYQAPGRVNLIGEYTDYNDGFVLPAAINFHTVIAVKRR
EDSKFRAVADAFPGQIKEWTFGKETEIHPEDGWVNYLKGFTAAMANTGLIAKGLDLAVVG
DVPLAAGLSSSGALVVAFGTAISDSSQLHLSPMAVAQLAQRGEYRYVASACSIMDHMVCA
MGEPDHALLIDCLDLDSEAIAIPENLSLIIIDAHIEKQRLATISQQRREECAQAAEFFGL
DALRHLDLRQLESAKNKLDETLYRRAKHVVTENKRTQSAARALEQNNISKFSLLMAQSHQ
SLRDDFEVTLPEFDTLVDIVSQVIGERGGIRMTDGCVVALVDHELTDAVVSAVEQAFFEQ
TGIDATVYLCSASSGAGRIDS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory