SitesBLAST
Comparing 200106 FitnessBrowser__MR1:200106 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
47% identity, 93% coverage: 4:396/424 of query aligns to 11:420/425 of O59010
- S65 (= S52) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ S257) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ SSS 257:259) binding
- M311 (= M293) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (= T296) binding
- V355 (= V337) binding
- D394 (= D370) binding
- M395 (= M371) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R373) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N377) binding
- D405 (= D381) mutation to N: Strongly decreased affinity for aspartate.
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
47% identity, 94% coverage: 1:400/424 of query aligns to 4:422/425 of 6zgbA
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
47% identity, 94% coverage: 1:400/424 of query aligns to 6:424/426 of 6xwnB
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
47% identity, 94% coverage: 1:400/424 of query aligns to 3:421/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L3 (≠ M1), L191 (≠ K176), G195 (≠ M180), R282 (≠ K268)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ S257), S272 (= S258), S273 (= S259), M307 (= M293), T310 (= T296), G353 (= G339), A354 (= A340), R394 (= R373), T395 (= T374)
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
47% identity, 94% coverage: 1:400/424 of query aligns to 6:424/427 of 5e9sA
- binding aspartic acid: R274 (≠ S257), S275 (= S258), S276 (= S259), T313 (= T296), G353 (= G336), V354 (= V337), A357 (= A340), G358 (= G341), D394 (= D370), R397 (= R373), T398 (= T374)
- binding decyl-beta-d-maltopyranoside: L194 (≠ K176), G198 (≠ M180), Y202 (≠ L184)
- binding sodium ion: Y87 (= Y77), T90 (= T80), S91 (≠ T81), S276 (= S259), G305 (= G288), A306 (≠ T289), T307 (= T290), N309 (= N292), N309 (= N292), M310 (= M293), D311 (= D294), S348 (= S331), I349 (= I332), G350 (= G333), T351 (= T334), N401 (= N377), V402 (= V378), D405 (= D381)
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
47% identity, 94% coverage: 4:400/424 of query aligns to 2:413/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ S257), S265 (= S259), M299 (= M293), T302 (= T296), T340 (= T334), G342 (= G336), V343 (= V337), G347 (= G341), D383 (= D370), R386 (= R373), T387 (= T374), N390 (= N377)
- binding decyl-beta-d-maltopyranoside: H23 (≠ E25), V212 (≠ L205), A216 (≠ I209)
2nwwA Crystal structure of gltph in complex with tboa (see paper)
46% identity, 92% coverage: 4:392/424 of query aligns to 2:407/407 of 2nwwA
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
47% identity, 92% coverage: 4:392/424 of query aligns to 3:408/409 of 6bavA
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
47% identity, 92% coverage: 4:392/424 of query aligns to 3:408/408 of 6bauA
- binding cysteine: S270 (= S259), M303 (= M293), T306 (= T296), A345 (= A335), G346 (= G336), V347 (= V337), G351 (= G341), D386 (= D370), C389 (≠ R373), T390 (= T374), N393 (= N377)
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
46% identity, 92% coverage: 4:395/424 of query aligns to 11:419/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ I33), F46 (≠ I33), P75 (≠ D62), L91 (≠ C79), F95 (≠ I83), L130 (≠ V118), I133 (≠ T121), I159 (≠ V147), Y167 (≠ L155), K196 (= K176), G200 (≠ M180), I207 (≠ Y187), F210 (= F190), L250 (≠ V230), I262 (≠ F243), M269 (= M250), T334 (= T316), V335 (≠ W317), G336 (≠ V318), T340 (= T322), L343 (= L325), M399 (≠ V375)
- binding aspartic acid: S277 (= S258), S278 (= S259), T314 (= T296), G354 (= G336), A358 (= A340), G359 (= G341), D394 (= D370), R397 (= R373), T398 (= T374)
- binding sodium ion: Y89 (= Y77), T92 (= T80), S93 (≠ T81), G306 (= G288), T308 (= T290), N310 (= N292), N310 (= N292), M311 (= M293), D312 (= D294), S349 (= S331), I350 (= I332), T352 (= T334), N401 (= N377), V402 (= V378), D405 (= D381)
Sites not aligning to the query:
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
46% identity, 92% coverage: 4:392/424 of query aligns to 8:413/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (= G56), V83 (≠ F74), I157 (≠ A148), Y164 (≠ L155), K193 (= K176), T305 (= T290), I306 (= I291), I347 (= I332)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (= I9), M199 (= M182), S275 (= S259), T311 (= T296), G356 (= G341), L384 (≠ A363), D391 (= D370), R394 (= R373)
Sites not aligning to the query:
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
44% identity, 92% coverage: 4:392/424 of query aligns to 3:396/396 of 6bmiA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
37% identity, 88% coverage: 25:399/424 of query aligns to 48:410/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ K65), G89 (= G67), G92 (= G70), A95 (≠ S73), V96 (≠ F74), Y99 (= Y77), M163 (≠ V147), F167 (≠ I151), F293 (= F283), V297 (≠ L287)
- binding aspartic acid: S268 (= S258), S269 (= S259), T306 (= T296), G346 (= G336), I347 (≠ V337), A350 (= A340), G351 (= G341), D380 (= D370), R383 (= R373), T384 (= T374)
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
38% identity, 88% coverage: 25:399/424 of query aligns to 40:396/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ V57), S80 (≠ K65), G81 (= G67), G84 (= G70), Y91 (= Y77), M156 (≠ V147), F160 (≠ I151), F286 (= F283), V290 (≠ L287)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (≠ V49), I148 (= I139), S262 (= S259), S263 (≠ A260), A292 (≠ T289), T293 (= T290), M296 (= M293), T299 (= T296), G329 (= G333), A336 (= A340), G337 (= G341), D366 (= D370), R369 (= R373), N373 (= N377)
P43006 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; Solute carrier family 1 member 2 from Mus musculus (Mouse) (see paper)
32% identity, 97% coverage: 14:423/424 of query aligns to 51:534/572 of P43006
Sites not aligning to the query:
- 38 modified: S-palmitoyl cysteine; C→S: Severely impairs glutamate uptake activity.
Q10901 Excitatory amino acid transporter; Sodium-dependent glutamate/ aspartate transporter from Caenorhabditis elegans (see paper)
35% identity, 96% coverage: 14:420/424 of query aligns to 30:489/503 of Q10901
- N177 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N187 (≠ S136) modified: carbohydrate, N-linked (GlcNAc...) asparagine
O35874 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Mus musculus (Mouse) (see 2 papers)
32% identity, 95% coverage: 14:416/424 of query aligns to 49:516/532 of O35874
- N201 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N206 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
P31596 Excitatory amino acid transporter 2; GLT-1; Sodium-dependent glutamate/aspartate transporter 2; GLUT-R; Solute carrier family 1 member 2 from Rattus norvegicus (Rat) (see paper)
32% identity, 97% coverage: 14:423/424 of query aligns to 51:535/573 of P31596
- K298 (vs. gap) mutation K->H,R: Normal transporter activity.; mutation K->N,T: Reduced transporter activity.
- H326 (= H222) mutation H->N,T,K,R: No transporter activity.
7xr4A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with glutamate (see paper)
36% identity, 90% coverage: 14:396/424 of query aligns to 15:420/425 of 7xr4A
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
36% identity, 90% coverage: 14:396/424 of query aligns to 16:419/424 of 7xr6A
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S280 (= S258), S281 (= S259), T318 (= T296), G363 (= G341), M367 (≠ L345), V385 (≠ A363), D388 (= D366), R395 (= R373), T396 (= T374)
- binding dodecyl beta-D-glucopyranoside: V16 (= V14), V19 (≠ I17), I20 (≠ L18), W389 (≠ R367)
- binding cholesterol hemisuccinate: R80 (= R68), R84 (≠ K72), I95 (= I83), I252 (≠ V230)
Query Sequence
>200106 FitnessBrowser__MR1:200106
MSVPLWLQIFVGMVLGILVGVTLGEQASYLKPIGTLFVNTIKMLIVPLVFCSLIVGVTSM
EDTAKMGRIGFKSFSFYLCTTAIAISLGLVVGYVIQPGAGVPLLQHEAVNTAKEVPSVMQ
TLIDIVPTNPVAALASGQILQVIVFAVALGIALVLIGDHGKPAIKVFESLAEAMYKLTDM
VMKLAPYGVFGLMAWVAGEYGIDMLWPLIKVIIAVYIGCIIHVLGFYSIVLRLFAKLNPL
HFFKGISNAMAVAFTTSSSAGTLPASMKCASEYLGVNKKISSFVLPLGTTINMDGTALYQ
GVTALFVAQAFGIDLTWVDYLTIILTATLASIGTAGVPGAGLVMLTLVLSTVGLPLEGVA
LIAGIDRILDMARTVVNVSGDLVATTVIAKSENELDVEHYNADMVQSAVIAEQNAANESA
ATQR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory