SitesBLAST
Comparing 200140 FitnessBrowser__MR1:200140 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1hyuA Crystal structure of intact ahpf (see paper)
59% identity, 97% coverage: 1:511/527 of query aligns to 1:517/521 of 1hyuA
- binding flavin-adenine dinucleotide: G221 (= G219), P222 (= P220), A223 (= A221), E243 (≠ D241), G247 (= G245), Q248 (= Q246), N257 (= N255), S289 (≠ K287), A290 (= A288), T322 (= T316), G323 (= G317), W326 (= W320), C345 (= C339), D488 (= D482), K495 (= K489), Q496 (= Q490), I497 (= I491)
4ykgA Crystal structure of the alkylhydroperoxide reductase subunit f (ahpf) with NAD+ from escherichia coli (see paper)
59% identity, 97% coverage: 1:511/527 of query aligns to 1:517/521 of 4ykgA
- active site: C345 (= C339), C348 (= C342), D349 (= D343)
- binding flavin-adenine dinucleotide: G221 (= G219), P222 (= P220), A223 (= A221), G242 (≠ A240), E243 (≠ D241), G247 (= G245), Q248 (= Q246), T252 (= T250), N257 (= N255), S289 (≠ K287), A290 (= A288), T322 (= T316), G323 (= G317), C348 (= C342), G487 (= G481), D488 (= D482), Q496 (= Q490), I497 (= I491)
- binding nicotinamide-adenine-dinucleotide: I361 (= I355), G364 (= G358), S366 (= S360), E385 (= E379), F386 (= F380), I449 (= I443), M467 (≠ R461), P493 (= P487)
4ykfA Crystal structure of the alkylhydroperoxide reductase subunit f (ahpf) with nadh from escherichia coli (see paper)
59% identity, 97% coverage: 1:511/527 of query aligns to 1:517/521 of 4ykfA
- active site: C345 (= C339), C348 (= C342), D349 (= D343)
- binding flavin-adenine dinucleotide: G221 (= G219), P222 (= P220), A223 (= A221), G242 (≠ A240), E243 (≠ D241), G247 (= G245), Q248 (= Q246), N257 (= N255), A290 (= A288), T322 (= T316), G323 (= G317), C348 (= C342), N454 (= N448), D488 (= D482), Q496 (= Q490), I497 (= I491)
- binding 1,4-dihydronicotinamide adenine dinucleotide: I361 (= I355), G364 (= G358), N365 (= N359), S366 (= S360), E385 (= E379), F386 (= F380), K391 (≠ R385), I449 (= I443), M467 (≠ R461)
P35340 Alkyl hydroperoxide reductase subunit F; Alkyl hydroperoxide reductase F52A protein; EC 1.8.1.- from Escherichia coli (strain K12) (see paper)
59% identity, 97% coverage: 1:511/527 of query aligns to 1:517/521 of P35340
- K53 (= K53) modified: N6-acetyllysine
- K354 (= K348) modified: N6-acetyllysine
3ctyB Crystal structure of t. Acidophilum thioredoxin reductase (see paper)
40% identity, 56% coverage: 211:506/527 of query aligns to 5:300/305 of 3ctyB
- active site: A38 (vs. gap), T42 (≠ V247), L47 (≠ G252), N50 (= N255), C133 (= C339), C136 (= C342), D137 (= D343)
- binding flavin-adenine dinucleotide: V10 (= V216), G11 (= G217), A15 (= A221), D34 (= D241), K35 (= K242), G40 (= G245), L41 (≠ Q246), T42 (≠ V247), A45 (≠ T250), P46 (≠ V251), N50 (= N255), V82 (≠ I282), T110 (= T316), G111 (= G317), S154 (= S360), Q241 (≠ N448), G275 (= G481), D276 (= D482), A283 (≠ K489), Q284 (= Q490), I285 (= I491)
7jypA Structure of thioredoxin reductase from the thermophilic eubacterium thermosipho africanus tcf52b
38% identity, 56% coverage: 208:501/527 of query aligns to 3:296/305 of 7jypA
- binding flavin-adenine dinucleotide: G12 (= G217), G14 (= G219), P15 (= P220), A16 (= A221), F34 (≠ V239), E35 (≠ A240), K36 (≠ D241), G41 (= G245), A42 (≠ Q246), V83 (≠ A288), T112 (= T316), G113 (= G317), G276 (= G481), D277 (= D482)
- binding nicotinamide-adenine-dinucleotide: G153 (= G357), G154 (= G358), S156 (= S360), Q175 (≠ E379), N176 (≠ F380), T181 (≠ R385), V238 (≠ I443)
5uwyA The crystal structure of thioredoxin reductase from streptococcus pyogenes mgas5005
35% identity, 57% coverage: 209:509/527 of query aligns to 3:303/306 of 5uwyA
- binding flavin-adenine dinucleotide: G13 (= G219), P14 (= P220), A15 (= A221), E34 (≠ A240), Q35 (≠ D241), G40 (= G245), Q41 (= Q246), T45 (= T250), N50 (= N255), V82 (vs. gap), T110 (= T316), G111 (= G317), Y114 (≠ W320), C136 (= C342), V242 (≠ N448), G275 (= G481), D276 (= D482), Q284 (= Q490), I285 (= I491)
5mh4A Crystal structure of lactococcus lactis thioredoxin reductase (fr conformation) (see paper)
33% identity, 57% coverage: 211:510/527 of query aligns to 2:301/303 of 5mh4A
- active site: V34 (≠ F243), P35 (vs. gap), M39 (≠ V247), E44 (≠ G252), C130 (= C339), C133 (= C342), D134 (= D343)
- binding flavin-adenine dinucleotide: G10 (= G219), P11 (= P220), A12 (= A221), E31 (≠ A240), R32 (≠ D241), G37 (= G245), Q38 (= Q246), T42 (= T250), N47 (= N255), G77 (≠ A288), V79 (vs. gap), T107 (= T316), G108 (= G317), E155 (≠ A364), V239 (≠ N448), F242 (≠ W451), G272 (= G481), D273 (= D482), Q281 (= Q490), I282 (= I491)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: I146 (= I355), G147 (= G356), G148 (= G357), G149 (= G358), D150 (≠ N359), S151 (= S360), E154 (= E363), H170 (≠ E379), R171 (≠ F380), R172 (≠ D381), R176 (= R385), V234 (≠ I443), G235 (= G444), R280 (≠ K489), Q281 (= Q490)
P9WHH1 Thioredoxin reductase; TR; TRXR; EC 1.8.1.9 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
35% identity, 59% coverage: 212:523/527 of query aligns to 16:328/335 of P9WHH1
- SGPA 22:25 (≠ GGPA 218:221) binding
- Y32 (= Y228) modified: Phosphotyrosine; by PtkA; mutation to A: Significantly reduces phosphorylation.
- 44:51 (vs. 240:246, 38% identical) binding
- N60 (= N255) binding
- V93 (≠ Q286) binding
- C145 (= C339) modified: Disulfide link with 148, Redox-active
- C148 (= C342) modified: Disulfide link with 145, Redox-active
- S166 (= S360) binding
- H185 (≠ E379) binding
- R191 (= R385) binding
- I248 (= I443) binding
- Y268 (≠ E463) binding
- D288 (= D482) binding
- R295 (≠ K489) binding
- RQAV 295:298 (≠ KQII 489:492) binding
2a87A Crystal structure of m. Tuberculosis thioredoxin reductase (see paper)
36% identity, 57% coverage: 212:513/527 of query aligns to 7:310/313 of 2a87A
- active site: F39 (= F243), L43 (≠ V247), D48 (≠ G252), C136 (= C339), C139 (= C342), D140 (= D343)
- binding flavin-adenine dinucleotide: G12 (= G217), S13 (≠ G218), G14 (= G219), P15 (= P220), A16 (= A221), F34 (≠ V239), E35 (vs. gap), G36 (≠ A240), G40 (= G244), G41 (= G245), A42 (≠ Q246), L43 (≠ V247), T46 (= T250), V49 (≠ I253), N51 (= N255), D83 (≠ N285), V84 (≠ Q286), M113 (≠ T316), C139 (= C342), G278 (= G481), D279 (= D482), R286 (≠ K489), Q287 (= Q490), A288 (≠ I491), V289 (≠ I492)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L120 (≠ M323), G155 (= G358), D156 (≠ N359), S157 (= S360), H176 (≠ E379), R177 (≠ F380), R178 (≠ D381), R182 (= R385), I239 (= I443), Y259 (≠ E463), R283 (≠ S486), R286 (≠ K489)
7aawA Thioredoxin reductase from bacillus cereus (see paper)
32% identity, 58% coverage: 205:509/527 of query aligns to 1:305/315 of 7aawA
- binding flavin-adenine dinucleotide: G13 (= G217), G15 (= G219), P16 (= P220), A17 (= A221), E36 (≠ A240), R37 (≠ D241), G42 (= G245), Q43 (= Q246), T47 (= T250), N52 (= N255), G82 (≠ N285), V84 (= V289), A111 (= A315), S112 (≠ T316), G113 (= G317), C138 (= C342), G277 (= G481), D278 (= D482), Q286 (= Q490), I287 (= I491)
- binding alpha-D-glucopyranose: R27 (= R231), D49 (≠ G252), K74 (≠ D277), F75 (≠ Y278), P122 (= P326), G123 (= G327), E126 (= E330), G129 (= G333), G131 (= G335), V132 (= V336), F143 (= F347), E206 (= E410), N208 (≠ T412)
8ccmA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with compound 2-06
35% identity, 57% coverage: 211:509/527 of query aligns to 3:302/305 of 8ccmA
- binding flavin-adenine dinucleotide: I8 (≠ V216), G9 (= G217), S10 (≠ G218), G11 (= G219), P12 (= P220), A13 (= A221), E32 (vs. gap), G33 (≠ A240), Q35 (≠ K242), G38 (= G245), A39 (≠ Q246), L40 (≠ V247), T43 (= T250), N48 (= N255), D80 (≠ N285), V81 (≠ Q286), M109 (≠ T316), G110 (= G317), T131 (≠ Y338), C135 (= C342), G274 (= G481), D275 (= D482), R282 (≠ K489), Q283 (= Q490), A284 (≠ I491), A287 (= A494)
- binding ~{N}6-(4-aminophenyl)-1,2-benzothiazole-3,6-diamine: R114 (= R321), H115 (≠ E322), L116 (≠ M323), R173 (≠ F380), E200 (≠ M407), I201 (≠ T408), I235 (= I443)
8cclA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry a09
35% identity, 57% coverage: 211:509/527 of query aligns to 3:302/305 of 8cclA
- binding flavin-adenine dinucleotide: I8 (≠ V216), G9 (= G217), S10 (≠ G218), G11 (= G219), P12 (= P220), A13 (= A221), E32 (vs. gap), G33 (≠ A240), Q35 (≠ K242), G38 (= G245), A39 (≠ Q246), L40 (≠ V247), T43 (= T250), N48 (= N255), D80 (≠ N285), V81 (≠ Q286), M109 (≠ T316), G110 (= G317), T131 (≠ Y338), C135 (= C342), G274 (= G481), D275 (= D482), R282 (≠ K489), Q283 (= Q490), A284 (≠ I491), A287 (= A494)
- binding [1,2]thiazolo[5,4-b]pyridin-3-amine: L116 (≠ M323), R173 (≠ F380), E200 (≠ M407), I201 (≠ T408)
8cckA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with fragment f2x-entry h07
35% identity, 57% coverage: 211:509/527 of query aligns to 3:302/305 of 8cckA
- binding flavin-adenine dinucleotide: G9 (= G217), S10 (≠ G218), G11 (= G219), P12 (= P220), A13 (= A221), E32 (vs. gap), G33 (≠ A240), Q35 (≠ K242), G38 (= G245), A39 (≠ Q246), L40 (≠ V247), T43 (= T250), N48 (= N255), D80 (≠ N285), V81 (≠ Q286), M109 (≠ T316), G110 (= G317), T131 (≠ Y338), C135 (= C342), G274 (= G481), D275 (= D482), R282 (≠ K489), Q283 (= Q490), A284 (≠ I491), A287 (= A494)
- binding ~{N}-(4-hydroxyphenyl)-2-pyrazol-1-yl-ethanamide: R114 (= R321), H115 (≠ E322), L116 (≠ M323), V148 (≠ I355), R173 (≠ F380), E200 (≠ M407), I201 (≠ T408)
8ccjA Crystal structure of mycobacterium smegmatis thioredoxin reductase in complex with NADPH
35% identity, 57% coverage: 211:509/527 of query aligns to 3:302/305 of 8ccjA
- binding flavin-adenine dinucleotide: I8 (≠ V216), G9 (= G217), S10 (≠ G218), G11 (= G219), P12 (= P220), A13 (= A221), E32 (vs. gap), G33 (≠ A240), Q35 (≠ K242), G38 (= G245), A39 (≠ Q246), L40 (≠ V247), T43 (= T250), N48 (= N255), D80 (≠ N285), V81 (≠ Q286), M109 (≠ T316), G110 (= G317), T131 (≠ Y338), C135 (= C342), G274 (= G481), D275 (= D482), R282 (≠ K489), Q283 (= Q490), A284 (≠ I491), A287 (= A494)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G150 (= G357), G151 (= G358), D152 (≠ N359), S153 (= S360), E156 (= E363), H172 (≠ E379), R173 (≠ F380), R174 (≠ D381), R178 (= R385), I235 (= I443)
5uthA Crystal structure of thioredoxin reductase from mycobacterium smegmatis in complex with fad
35% identity, 57% coverage: 211:509/527 of query aligns to 4:303/306 of 5uthA
- active site: C133 (= C339), C136 (= C342), D137 (= D343)
- binding flavin-adenine dinucleotide: I9 (≠ V216), G10 (= G217), S11 (≠ G218), G12 (= G219), P13 (= P220), A14 (= A221), F32 (≠ V239), E33 (vs. gap), G34 (≠ A240), Q36 (≠ K242), G39 (= G245), A40 (≠ Q246), L41 (≠ V247), N49 (= N255), D81 (≠ N285), V82 (≠ Q286), M110 (≠ T316), G111 (= G317), C136 (= C342), G275 (= G481), D276 (= D482), R283 (≠ K489), Q284 (= Q490), A285 (≠ I491), A288 (= A494)
2q7vA Crystal structure of deinococcus radiodurans thioredoxin reductase (see paper)
35% identity, 56% coverage: 211:503/527 of query aligns to 8:304/313 of 2q7vA
- active site: P41 (vs. gap), I45 (≠ V247), E50 (≠ G252), C141 (= C339), C144 (= C342), D145 (= D343)
- binding flavin-adenine dinucleotide: G16 (= G219), P17 (= P220), A18 (= A221), E37 (≠ A240), K38 (≠ D241), G43 (= G245), Q44 (= Q246), I45 (≠ V247), N53 (= N255), E85 (≠ D284), V86 (≠ N285), T118 (= T316), G119 (= G317), C144 (= C342), G282 (= G481), D283 (= D482), Q291 (= Q490), L292 (≠ I491), S295 (≠ A494)
7aawB Thioredoxin reductase from bacillus cereus (see paper)
33% identity, 57% coverage: 211:509/527 of query aligns to 4:302/311 of 7aawB
- binding flavin-adenine dinucleotide: G10 (= G217), G12 (= G219), P13 (= P220), A14 (= A221), E33 (≠ A240), R34 (≠ D241), G39 (= G245), Q40 (= Q246), T44 (= T250), N49 (= N255), G79 (≠ N285), D80 (≠ Q286), V81 (= V289), S109 (≠ T316), G110 (= G317), Y113 (≠ W320), C135 (= C342), G274 (= G481), D275 (= D482), Q283 (= Q490), I284 (= I491)
- binding alpha-D-glucopyranose: D46 (≠ G252), E48 (= E254), G126 (= G333), G128 (= G335), D136 (= D343), A138 (≠ P345), F139 (≠ L346), F139 (≠ L346), F140 (= F347)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G150 (= G357), G151 (= G358), D152 (≠ N359), S153 (= S360), E156 (= E363), H172 (≠ E379), R173 (≠ F380), R174 (≠ D381), R178 (= R385), I236 (= I443)
3f8rA Crystal structure of sulfolobus solfataricus thioredoxin reductase b3 in complex with two NADP molecules (see paper)
31% identity, 57% coverage: 211:509/527 of query aligns to 7:305/308 of 3f8rA
- active site: C133 (= C339), C136 (= C342), D137 (= D343)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V12 (= V216), G13 (= G217), L14 (≠ G218), G15 (= G219), P16 (= P220), A17 (= A221), E37 (≠ D241), T38 (≠ K242), G41 (= G245), Q42 (= Q246), I82 (≠ A288), V83 (= V289), G109 (≠ A315), I110 (≠ T316), G111 (= G317), R115 (= R321), L117 (≠ M323), D153 (≠ N359), S154 (= S360), E157 (= E363), R174 (≠ F380), R175 (≠ D381), Y184 (≠ L390), I236 (= I443), G275 (= G481), D276 (= D482), L282 (vs. gap), G283 (vs. gap), R285 (≠ K489)
5u63B Crystal structure of putative thioredoxin reductase from haemophilus influenzae
38% identity, 57% coverage: 212:509/527 of query aligns to 11:316/319 of 5u63B
- active site: C139 (= C339), C142 (= C342), D143 (= D343)
- binding flavin-adenine dinucleotide: G16 (= G217), S17 (≠ G218), G18 (= G219), P19 (= P220), A20 (= A221), T39 (≠ A240), G40 (≠ D241), Q42 (≠ K242), G45 (= G245), Q46 (= Q246), L47 (≠ V247), T50 (= T250), N55 (= N255), H87 (≠ N285), I88 (≠ Q286), A115 (= A315), T116 (= T316), G117 (= G317), H248 (≠ L445), G288 (= G481), D289 (= D482), R296 (≠ K489), Q297 (= Q490), A298 (≠ I491), S301 (≠ A494)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R121 (= R321), G157 (= G357), H179 (≠ E379), R180 (≠ F380), R181 (≠ D381), I246 (= I443), G247 (= G444), H248 (≠ L445), R296 (≠ K489)
Query Sequence
>200140 FitnessBrowser__MR1:200140
MLDANLKNQLQTYLQNLKRPVELVVSADESKKSQELKSLVNDIVSLSTFVSLKEAQGQRT
PAMTVVNPALNTQISFAGLPMGHEFTSLVLALLHSGGHPIKLSDDIIEQIRNLPGKYEFE
TYVSLTCQNCPDVVQALNMMAAINPNITNVMIDGALFQDEVASRNIMAVPSVYLNGEVFA
AGRISIGEILNKLDTGAASRKAEELSQKAPYEVLVVGGGPAGAAAAIYAARKGLRTGIVA
DKFGGQVAETVGIENFISVKATEGPKLVANLEAHVRDYEVDIMDNQKAVKLASDGLFELE
LASGAKLRSRTVLLATGARWREMNVPGEKEYRGKGVAYCPHCDGPLFKGKRVAVIGGGNS
GIEAAIDLANIVEHVTVLEFDSKLRADDVLQRKAASMGNIKIITQAMTTEVTGDGTRVNG
LNYTDRATGESHHIALAGIFVQIGLVPNAEWLKGTVDLTPRGEIIVDERGQTSVPGVFAA
GDVTNSPYKQIIIAMGSGANASLGAFDYLIRHSDDSTETKTTDTKAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory