Comparing 200162 FitnessBrowser__MR1:200162 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
2qcuB Crystal structure of glycerol-3-phosphate dehydrogenase from escherichia coli (see paper)
31% identity, 88% coverage: 28:370/391 of query aligns to 28:367/501 of 2qcuB
Sites not aligning to the query:
2r46A Crystal structure of escherichia coli glycerol-3-phosphate dehydrogenase in complex with 2-phosphopyruvic acid. (see paper)
31% identity, 88% coverage: 28:370/391 of query aligns to 28:367/495 of 2r46A
Sites not aligning to the query:
2r45A Crystal structure of escherichia coli glycerol-3-phosphate dehydrogenase in complex with 2-phospho-d-glyceric acid (see paper)
31% identity, 88% coverage: 28:370/391 of query aligns to 28:367/495 of 2r45A
Sites not aligning to the query:
Q9SS48 Glycerol-3-phosphate dehydrogenase SDP6, mitochondrial; Protein SUGAR-DEPENDENT 6; EC 1.1.5.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
30% identity, 99% coverage: 5:390/391 of query aligns to 75:470/629 of Q9SS48
Sites not aligning to the query:
2rgoA Structure of alpha-glycerophosphate oxidase from streptococcus sp.: A template for the mitochondrial alpha-glycerophosphate dehydrogenase (see paper)
28% identity, 93% coverage: 25:389/391 of query aligns to 40:416/557 of 2rgoA
Sites not aligning to the query:
2rgoB Structure of alpha-glycerophosphate oxidase from streptococcus sp.: A template for the mitochondrial alpha-glycerophosphate dehydrogenase (see paper)
28% identity, 93% coverage: 25:389/391 of query aligns to 38:408/530 of 2rgoB
Sites not aligning to the query:
3da1A X-ray structure of the glycerol-3-phosphate dehydrogenase from bacillus halodurans complexed with fad. Northeast structural genomics consortium target bhr167.
26% identity, 92% coverage: 22:381/391 of query aligns to 37:344/496 of 3da1A
Sites not aligning to the query:
Q9HUH4 Probable FAD-dependent oxidoreductase PA4991; EC 1.-.-.- from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
42% identity, 15% coverage: 3:62/391 of query aligns to 6:65/391 of Q9HUH4
Sites not aligning to the query:
5ez7A Crystal structure of the fad dependent oxidoreductase pa4991 from pseudomonas aeruginosa (see paper)
46% identity, 13% coverage: 3:52/391 of query aligns to 6:55/363 of 5ez7A
Sites not aligning to the query:
>200162 FitnessBrowser__MR1:200162
MSSYDIAIIGGGISGVGIAQYAAAAGYSTLLIEKGEIGGQTSANSSKLIHGGLRYLESGQ
INLVRKSLLERRNLLDLAPSLVKPVAFYIPVYQDSRRNPLTIRAGLSLYALLSEFDPLGR
FVSIPAVHWHRFKGLKLSGLKAVFQYWDAQTDDKLLTQAVARSAQALGAHIYAEAEFLQL
NHLKEQIELSFRHRGEVQQIETKLVINAAGPWVNEVLAHVEPPLAGVEIDWVQGAHLLLD
LPAPEGILYLESCFDKRVIFVMPWYGQMLIGTTETVLTSIDTPPQVTESETQYLLGIYCH
YFPLSPSIEELKTKIVQTYCGVRVLPKQASSAFERPRDTLMQTSISHPRLLCLYGGKLTT
FRSSSAEVLEWIEQKLGKRQPIADIDTLKLT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory