SitesBLAST
Comparing 200200 FitnessBrowser__MR1:200200 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7p61F Complex i from e. Coli, ddm-purified, with nadh, resting state (see paper)
79% identity, 95% coverage: 20:457/461 of query aligns to 6:441/442 of 7p61F
- binding flavin mononucleotide: G61 (= G75), G63 (= G77), K72 (= K86), N90 (= N104), D92 (= D106), G181 (= G195), E182 (= E196), N217 (= N231), N218 (= N232), A399 (= A415), H400 (= H416)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G63 (= G77), G64 (= G78), A65 (= A79), F67 (= F81), K72 (= K86), L75 (= L89), E95 (= E109), Y178 (= Y192), E183 (= E197), F203 (= F217), R320 (= R336), T323 (= T339)
- binding iron/sulfur cluster: S350 (= S366), C351 (= C367), W353 (= W369), C354 (= C370), C357 (= C373), F397 (= F413), C398 (= C414), H400 (= H416)
Q56222 NADH-quinone oxidoreductase subunit 1; NADH dehydrogenase I chain 1; NDH-1 subunit 1; EC 7.1.1.- from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
47% identity, 86% coverage: 40:437/461 of query aligns to 29:423/438 of Q56222
4hea1 Crystal structure of the entire respiratory complex i from thermus thermophilus (see paper)
47% identity, 86% coverage: 40:437/461 of query aligns to 28:422/437 of 4hea1
- binding flavin mononucleotide: G63 (= G75), K74 (= K86), N91 (= N104), D93 (= D106), Y179 (= Y192), G182 (= G195), E183 (= E196), N218 (= N231), N219 (= N232), L401 (≠ H416)
- binding iron/sulfur cluster: I180 (= I193), P198 (= P211), S351 (= S366), C352 (= C367), G353 (= G368), K354 (≠ W369), C355 (= C370), C358 (= C373), F398 (= F413), C399 (= C414), L401 (≠ H416)
2ybb1 Fitted model for bovine mitochondrial supercomplex i1iii2iv1 by single particle cryo-em (emd-1876) (see paper)
47% identity, 86% coverage: 40:437/461 of query aligns to 28:422/437 of 2ybb1
- binding flavin mononucleotide: G63 (= G75), G65 (= G77), N91 (= N104), D93 (= D106), G182 (= G195), E183 (= E196), E184 (= E197), N218 (= N231), N219 (= N232), T222 (= T235), P400 (≠ A415)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G65 (= G77), G66 (= G78), F69 (= F81), K74 (= K86), F77 (≠ L89), E96 (= E109), Y179 (= Y192), E184 (= E197), K201 (= K214), F204 (= F217), T324 (= T339)
- binding iron/sulfur cluster: S351 (= S366), C352 (= C367), K354 (≠ W369), C355 (= C370), C358 (= C373), F398 (= F413), C399 (= C414), L401 (≠ H416), A402 (= A417)
8e9hF Mycobacterial respiratory complex i, fully-inserted quinone (see paper)
47% identity, 90% coverage: 26:441/461 of query aligns to 5:423/436 of 8e9hF
- binding flavin mononucleotide: G53 (= G75), R54 (= R76), G55 (= G77), A57 (= A79), K64 (= K86), N90 (= N104), D92 (= D106), Y178 (= Y192), G181 (= G195), E182 (= E196), E183 (= E197), N217 (= N231), N218 (= N232), S221 (≠ T235), L398 (≠ H416)
- binding iron/sulfur cluster: P197 (= P211), S349 (= S366), C350 (= C367), G351 (= G368), K352 (≠ W369), C353 (= C370), C356 (= C373), S394 (≠ T412), F395 (= F413), C396 (= C414), L398 (≠ H416), G399 (≠ A417)
- binding zinc ion: C333 (≠ S350), E371 (= E388), H420 (≠ G438)
Sites not aligning to the query:
7t30B Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn/NAD(h) bound state (see paper)
44% identity, 88% coverage: 36:440/461 of query aligns to 15:415/425 of 7t30B
- binding fe2/s2 (inorganic) cluster: C326 (≠ S350), C364 (≠ E388), H413 (≠ G438)
- binding flavin mononucleotide: G54 (= G75), G56 (= G77), K65 (= K86), N82 (= N104), D84 (= D106), E85 (= E107), G173 (= G195), E175 (= E197), N210 (= N232), G390 (≠ A415), L391 (≠ H416)
- binding nicotinamide-adenine-dinucleotide: G56 (= G77), G57 (= G78), A58 (= A79), F60 (= F81), K65 (= K86), F68 (≠ L89), E85 (= E107), E175 (= E197), R192 (≠ K214), F195 (= F217), I312 (≠ R336), M313 (= M337), S315 (≠ T339)
- binding iron/sulfur cluster: S342 (= S366), C343 (= C367), G344 (= G368), C346 (= C370), C349 (= C373), S387 (≠ T412), C389 (= C414), L391 (≠ H416), G392 (≠ A417)
Sites not aligning to the query:
7t2rB Structure of electron bifurcating ni-fe hydrogenase complex hydabcsl in fmn-free apo state (see paper)
44% identity, 88% coverage: 36:440/461 of query aligns to 15:415/425 of 7t2rB
Sites not aligning to the query:
8a6tB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from thermoanaerobacter kivui in the reduced state (see paper)
41% identity, 92% coverage: 16:440/461 of query aligns to 141:560/630 of 8a6tB
- binding flavin mononucleotide: G201 (= G77), N227 (= N104), E230 (= E107), N355 (= N232), G535 (≠ A415), L536 (≠ H416)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S320 (≠ E197), R337 (≠ K214), R340 (≠ F217), T341 (≠ P218), N342 (≠ A219), S433 (≠ G312)
- binding iron/sulfur cluster: S487 (= S366), C488 (= C367), G489 (= G368), C491 (= C370), C494 (= C373), C534 (= C414), L536 (≠ H416), G537 (≠ A417)
- binding zinc ion: C471 (≠ S350), H558 (≠ G438)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 31, 33, 36, 82, 85, 86
- binding iron/sulfur cluster: 575, 577, 582, 583, 585, 588, 592, 596, 597, 607, 612, 618, 622, 624, 626, 627
- binding zinc ion: 564
6q9cB Crystal structure of aquifex aeolicus nadh-quinone oxidoreductase subunits nuoe and nuof bound to nadh under anaerobic conditions (see paper)
46% identity, 86% coverage: 40:436/461 of query aligns to 30:414/418 of 6q9cB
- binding flavin mononucleotide: G64 (= G75), G66 (= G77), K75 (= K86), N91 (= N104), D93 (= D106), E94 (= E107), G182 (= G195), E183 (= E196), E184 (= E197), V217 (= V230), N218 (= N231), N219 (= N232), T222 (= T235), G393 (≠ A415)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G66 (= G77), G67 (= G78), A68 (= A79), F70 (= F81), K75 (= K86), E94 (= E107), E96 (= E109), Y179 (= Y192), E184 (= E197), Y204 (≠ F217)
- binding iron/sulfur cluster: P198 (= P211), T345 (≠ S366), C346 (= C367), G347 (= G368), Q348 (≠ W369), C349 (= C370), C352 (= C373), I391 (≠ F413), C392 (= C414), L394 (≠ H416), G395 (≠ A417)
6hl3B Wild-type nuoef from aquifex aeolicus - oxidized form bound to NAD+ (see paper)
46% identity, 86% coverage: 40:436/461 of query aligns to 29:413/416 of 6hl3B
- binding flavin mononucleotide: G63 (= G75), G65 (= G77), K74 (= K86), N90 (= N104), D92 (= D106), E93 (= E107), G181 (= G195), E182 (= E196), E183 (= E197), V216 (= V230), N217 (= N231), N218 (= N232), T221 (= T235)
- binding nicotinamide-adenine-dinucleotide: G65 (= G77), G66 (= G78), A67 (= A79), F69 (= F81), K74 (= K86), E95 (= E109), Y178 (= Y192), E183 (= E197), K200 (= K214), Y203 (≠ F217)
- binding iron/sulfur cluster: I179 (= I193), P197 (= P211), T344 (≠ S366), C345 (= C367), G346 (= G368), Q347 (≠ W369), C348 (= C370), C351 (= C373), S389 (≠ T412), I390 (≠ F413), C391 (= C414), L393 (≠ H416), G394 (≠ A417)
7q5yC Structure of nadh:ubichinon oxidoreductase (complex i) of the hyperthermophilic eubacterium aquifex aeolicus
46% identity, 86% coverage: 40:436/461 of query aligns to 31:415/419 of 7q5yC
- binding flavin mononucleotide: G65 (= G75), G67 (= G77), K76 (= K86), N92 (= N104), E95 (= E107), Y180 (= Y192), G183 (= G195), E184 (= E196), V218 (= V230), N219 (= N231), N220 (= N232), T223 (= T235)
- binding iron/sulfur cluster: T346 (≠ S366), C347 (= C367), G348 (= G368), Q349 (≠ W369), C350 (= C370), C353 (= C373), S391 (≠ T412), I392 (≠ F413), C393 (= C414), G396 (≠ A417)
6saqB Wild-type nuoef from aquifex aeolicus bound to nadh-oh (see paper)
46% identity, 86% coverage: 40:436/461 of query aligns to 30:414/419 of 6saqB
- binding flavin mononucleotide: G64 (= G75), G66 (= G77), K75 (= K86), N91 (= N104), D93 (= D106), E94 (= E107), Y179 (= Y192), G182 (= G195), E183 (= E196), N218 (= N231), N219 (= N232), T222 (= T235)
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2~{R},3~{S},4~{R},5~{R})-5-[[(1~{E},3~{Z})-5-azanyl-4-oxidanyl-5-oxidanylidene-penta-1,3-dienyl]-methanoyl-amino]-3,4-bis(oxidanyl)oxolan-2-yl]methyl hydrogen phosphate: G66 (= G77), G67 (= G78), A68 (= A79), F70 (= F81), K75 (= K86), E94 (= E107), E96 (= E109), T99 (= T112), E184 (= E197), Y204 (≠ F217), T318 (= T335)
- binding iron/sulfur cluster: P198 (= P211), T345 (≠ S366), C346 (= C367), G347 (= G368), Q348 (≠ W369), C349 (= C370), C352 (= C373), I391 (≠ F413), C392 (= C414), G395 (≠ A417)
7zm7B Cryoem structure of mitochondrial complex i from chaetomium thermophilum (inhibited by ddm) (see paper)
42% identity, 82% coverage: 62:440/461 of query aligns to 46:426/456 of 7zm7B
- binding flavin mononucleotide: G59 (= G75), G61 (= G77), K70 (= K86), N91 (= N104), D93 (= D106), G182 (= G195), E183 (= E196), E184 (= E197), A218 (≠ N231), N219 (= N232), A401 (= A415), L402 (≠ H416)
- binding iron/sulfur cluster: P198 (= P211), C354 (= C367), G355 (= G368), Q356 (≠ W369), C357 (= C370), C360 (= C373), T398 (= T412), C400 (= C414), L402 (≠ H416)
8oh5B Cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) (see paper)
42% identity, 91% coverage: 31:450/461 of query aligns to 107:524/584 of 8oh5B
- binding flavin mononucleotide: R154 (= R76), K164 (= K86), N181 (= N104), F269 (≠ Y192), E273 (= E196), E274 (= E197), I307 (≠ V230), N308 (= N231), N309 (= N232), G489 (≠ A415), L490 (≠ H416)
- binding nicotinamide-adenine-dinucleotide: G155 (= G77), G156 (= G78), F159 (= F81), F163 (≠ V85), E273 (= E196), E274 (= E197), K291 (= K214), F294 (= F217), G413 (= G338)
- binding iron/sulfur cluster: P288 (= P211), C442 (= C367), G443 (= G368), C445 (= C370), C448 (= C373), C488 (= C414), L490 (≠ H416), G491 (≠ A417)
- binding zinc ion: C425 (≠ S350), H512 (≠ G438), C518 (≠ D444), C523 (≠ I449)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 10, 41, 45
- binding iron/sulfur cluster: 531, 536, 540, 542, 546, 547, 548, 559, 566, 567, 568, 569, 572
7p8nB Tmhydabc- t. Maritima hydrogenase with bridge closed (see paper)
41% identity, 87% coverage: 40:441/461 of query aligns to 150:547/613 of 7p8nB
- binding flavin mononucleotide: G185 (= G75), R186 (= R76), G187 (= G77), N213 (= N104), D215 (= D106), E216 (= E107), G217 (≠ M108), F301 (≠ Y192), G304 (= G195), E305 (= E196), E306 (= E197), N340 (= N231), N341 (= N232), G521 (≠ A415), L522 (≠ H416)
- binding iron/sulfur cluster: P320 (= P211), S473 (= S366), C474 (= C367), G475 (= G368), K476 (≠ W369), C477 (= C370), C480 (= C373), L519 (≠ F413), C520 (= C414), L522 (≠ H416), G523 (≠ A417)
- binding zinc ion: C457 (≠ S350), H544 (≠ G438)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 31, 33, 34, 36, 67, 68, 69, 70, 71
- binding iron/sulfur cluster: 560, 567, 570, 571, 573, 577, 590, 592, 597, 599, 600, 601, 603, 607
- binding zinc ion: 549, 554
P25708 NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial; NDUFV1; Complex I-51kD; CI-51kD; NADH dehydrogenase flavoprotein 1; NADH-ubiquinone oxidoreductase 51 kDa subunit; EC 7.1.1.2 from Bos taurus (Bovine) (see paper)
44% identity, 82% coverage: 61:436/461 of query aligns to 73:447/464 of P25708
- C379 (= C367) binding
- C382 (= C370) binding
- C385 (= C373) binding
- C425 (= C414) binding
6zk91 Peripheral domain of open complex i during turnover (see paper)
44% identity, 82% coverage: 61:436/461 of query aligns to 45:419/430 of 6zk91
- binding flavin mononucleotide: G59 (= G75), G61 (= G77), K70 (= K86), N88 (= N104), D90 (= D106), E91 (= E107), G179 (= G195), E180 (= E196), A215 (≠ N231), N216 (= N232), A398 (= A415), L399 (≠ H416)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G61 (= G77), G62 (= G78), A63 (= A79), F65 (= F81), K70 (= K86), E93 (= E109), Y176 (= Y192), E181 (= E197), F201 (= F217), T323 (= T339)
- binding iron/sulfur cluster: I177 (= I193), P195 (= P211), C351 (= C367), G352 (= G368), Q353 (≠ W369), C354 (= C370), C357 (= C373), T395 (= T412), C397 (= C414), L399 (≠ H416)
5lnk1 Entire ovine respiratory complex i (see paper)
44% identity, 82% coverage: 61:436/461 of query aligns to 47:421/432 of 5lnk1
- binding fe2/s2 (inorganic) cluster: P96 (= P110), G97 (≠ N111)
- binding flavin mononucleotide: G61 (= G75), R62 (= R76), K72 (= K86), N90 (= N104), D92 (= D106), E93 (= E107), G94 (≠ M108), Y178 (= Y192), G181 (= G195), E182 (= E196), V216 (= V230), A217 (≠ N231), N218 (= N232), T221 (= T235), L401 (≠ H416)
- binding iron/sulfur cluster: P197 (= P211), S352 (= S366), C353 (= C367), Q355 (≠ W369), C356 (= C370), C359 (= C373), T397 (= T412), I398 (≠ F413), C399 (= C414)
7dgq8 NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial (see paper)
44% identity, 82% coverage: 61:436/461 of query aligns to 42:416/427 of 7dgq8
- binding flavin mononucleotide: G58 (= G77), K67 (= K86), N85 (= N104), D87 (= D106), E88 (= E107), G89 (≠ M108), C175 (= C194), G176 (= G195), A212 (≠ N231), N213 (= N232)
- binding iron/sulfur cluster: S347 (= S366), C348 (= C367), G349 (= G368), C351 (= C370), C354 (= C373), C394 (= C414), L396 (≠ H416)
- binding : R121 (≠ Y140), Y132 (≠ V151), Q139 (≠ R158), R143 (≠ E162), Y146 (≠ K165), E147 (≠ A166), F165 (= F184), R168 (≠ T187)
7q4vB Electron bifurcating hydrogenase - hydabc from a. Woodii (see paper)
41% identity, 92% coverage: 36:457/461 of query aligns to 127:542/599 of 7q4vB
- binding flavin mononucleotide: G166 (= G75), G168 (= G77), N196 (= N104), D198 (= D106), F284 (≠ Y192), G287 (= G195), E288 (= E196), E289 (= E197), N324 (= N232)
- binding iron/sulfur cluster: C457 (= C367), G458 (= G368), K459 (≠ W369), C460 (= C370), C463 (= C373), C503 (= C414), G506 (≠ A417)
- binding zinc ion: C440 (≠ S350), H527 (≠ G438), C533 (≠ S448)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 11, 16, 48, 49, 51, 52
- binding iron/sulfur cluster: 544, 551, 552, 553, 554, 555, 556, 557, 561, 562, 574, 581, 583, 584, 585, 586, 587, 591, 593, 595
Query Sequence
>200200 FitnessBrowser__MR1:200200
MSLPQSKVLTSFGTANRTPRAAETHPLTWRLRDDGQPVWLEEYQTKQGYDAVRKALGQMS
PDEIVSTVKDAGLKGRGGAGFPTGVKWGLMPKDESMNIRYLLCNADEMEPNTWKDRLLME
QLPHLLIEGMIISAKALKAYRGYIFLRGEYVDAAINLRRAVEEAKAAGLLGKNILGSGFD
FELFVHTGAGRYICGEETALINSLEGRRANPRAKPPFPAVSGVWGKPTCVNNVETLCNVP
AIIGNGVAWYHTLALPGSEDHGTKLMGFSGKVNNPGVWELPFGITARELFEGYAGGMRSG
YRLKAWQPGGAGTGFLLPEHLDAQMYTAGIGKVGTRMGTGLAMAVDDSISMVSLLRNMEE
FFARESCGWCTPCRDGLPWSVKLLRSLERGEGQEGDLATLEQLCNFLGPGKTFCAHAPGA
VEPLASAIKYFRSEFEAGIKGSGDNRKSIKGIQPNLLGERW
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory