Comparing 200216 FitnessBrowser__MR1:200216 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
39% identity, 87% coverage: 5:253/285 of query aligns to 14:265/265 of P07821
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
31% identity, 73% coverage: 17:223/285 of query aligns to 16:224/240 of 4ymuJ
Sites not aligning to the query:
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
32% identity, 70% coverage: 14:213/285 of query aligns to 16:217/229 of 6z67B
Sites not aligning to the query:
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
32% identity, 70% coverage: 14:213/285 of query aligns to 16:217/230 of 6z4wA
Sites not aligning to the query:
P0A9R7 Cell division ATP-binding protein FtsE from Escherichia coli (strain K12) (see paper)
36% identity, 70% coverage: 14:213/285 of query aligns to 14:215/222 of P0A9R7
8w6iD Cryo-em structure of escherichia coli str k12 ftsex complex with atp- gamma-s in peptidisc
36% identity, 70% coverage: 14:213/285 of query aligns to 14:215/219 of 8w6iD
Sites not aligning to the query:
Q2G506 ATM1-type heavy metal exporter; ATP-binding cassette transporter Atm1; NaAtm1; EC 7.-.-.- from Novosphingobium aromaticivorans (strain ATCC 700278 / DSM 12444 / CCUG 56034 / CIP 105152 / NBRC 16084 / F199) (see paper)
32% identity, 74% coverage: 15:226/285 of query aligns to 374:586/608 of Q2G506
Sites not aligning to the query:
4mrvA Structure of a bacterial atm1-family abc transporter (see paper)
32% identity, 74% coverage: 15:226/285 of query aligns to 367:579/600 of 4mrvA
Sites not aligning to the query:
4mrsA Structure of a bacterial atm1-family abc transporter (see paper)
32% identity, 74% coverage: 15:226/285 of query aligns to 367:579/600 of 4mrsA
Sites not aligning to the query:
4mrpA Structure of a bacterial atm1-family abc transporter (see paper)
32% identity, 74% coverage: 15:226/285 of query aligns to 367:579/600 of 4mrpA
Sites not aligning to the query:
4mrnA Structure of a bacterial atm1-family abc transporter (see paper)
32% identity, 74% coverage: 15:226/285 of query aligns to 367:579/600 of 4mrnA
6parA Structure of a bacterial atm1-family abc exporter with mgamppnp bound (see paper)
32% identity, 74% coverage: 15:226/285 of query aligns to 353:565/578 of 6parA
Sites not aligning to the query:
6pamA Structure of a bacterial atm1-family abc transporter with mgadp bound (see paper)
32% identity, 74% coverage: 15:226/285 of query aligns to 362:574/586 of 6pamA
Sites not aligning to the query:
8hd0A Cell divisome spg hydrolysis machinery ftsex-envc
36% identity, 70% coverage: 14:213/285 of query aligns to 14:215/218 of 8hd0A
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 80% coverage: 12:238/285 of query aligns to 27:251/378 of P69874
Sites not aligning to the query:
O65934 ABC transporter ATP-binding/permease protein Rv1747; EC 7.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 3 papers)
30% identity, 78% coverage: 2:222/285 of query aligns to 318:540/865 of O65934
Sites not aligning to the query:
6panA Structure of a bacterial atm1-family abc exporter with atp bound (see paper)
32% identity, 74% coverage: 15:226/285 of query aligns to 344:556/572 of 6panA
Sites not aligning to the query:
3c4jA Abc protein artp in complex with atp-gamma-s
29% identity, 78% coverage: 3:223/285 of query aligns to 4:226/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
29% identity, 78% coverage: 3:223/285 of query aligns to 4:226/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
29% identity, 78% coverage: 3:223/285 of query aligns to 4:226/242 of 2olkA
>200216 FitnessBrowser__MR1:200216
MALNVSQLSWTIEGKTILSGVNFALQRGEMLGLIGPNGAGKSSLLRCLYRFIRPTQGQIS
LFSQDISQLSPKAFACKVAVVQQDTPHYFDMTTEQLVAMGLTPHKGMFDSHSSGDSDKII
KALEKVGLSHKLHQQYERLSGGEKQRALIARAIVQQPLLLILDEPTNHLDVRYQIQILEL
VRSLGISVIASIHDLNLASALCDSLLLLDNGQVSAMGTPTEVLTEERIAQVFGVCAQVMP
HPQHANPLINYFYGYQKSYGYQKSKTDEEGAIHPPHIINGVKTPS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory