Comparing 200227 FitnessBrowser__MR1:200227 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
46% identity, 89% coverage: 23:239/244 of query aligns to 7:223/229 of 6svfA
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
45% identity, 86% coverage: 28:238/244 of query aligns to 6:220/226 of 4zv1A
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
45% identity, 86% coverage: 28:238/244 of query aligns to 6:218/225 of 4zv2A
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
39% identity, 89% coverage: 27:244/244 of query aligns to 2:223/224 of 4ymxA
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
40% identity, 89% coverage: 28:244/244 of query aligns to 12:229/229 of 5t0wA
2q2aA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
39% identity, 89% coverage: 22:238/244 of query aligns to 7:225/241 of 2q2aA
2pvuA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
39% identity, 88% coverage: 22:235/244 of query aligns to 1:216/235 of 2pvuA
Q9Z869 Probable ABC transporter arginine-binding protein ArtJ from Chlamydia pneumoniae (Chlamydophila pneumoniae) (see paper)
35% identity, 91% coverage: 16:238/244 of query aligns to 18:247/259 of Q9Z869
3qaxB Crystal structure analysis of the cpb0502
35% identity, 87% coverage: 27:238/244 of query aligns to 5:220/235 of 3qaxB
2q2cA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
40% identity, 85% coverage: 28:235/244 of query aligns to 3:212/231 of 2q2cA
4i62A 1.05 angstrom crystal structure of an amino acid abc transporter substrate-binding protein abpa from streptococcus pneumoniae canada mdr_19a bound to l-arginine
36% identity, 91% coverage: 23:244/244 of query aligns to 5:232/237 of 4i62A
4g4pA Crystal structure of glutamine-binding protein from enterococcus faecalis at 1.5 a (see paper)
35% identity, 88% coverage: 29:243/244 of query aligns to 17:234/235 of 4g4pA
3k4uE Crystal structure of putative binding component of abc transporter from wolinella succinogenes dsm 1740 complexed with lysine
35% identity, 86% coverage: 28:238/244 of query aligns to 6:221/234 of 3k4uE
2y7iA Structural basis for high arginine specificity in salmonella typhimurium periplasmic binding protein stm4351. (see paper)
32% identity, 87% coverage: 24:235/244 of query aligns to 4:219/228 of 2y7iA
4zefA Crystal structure of substrate binding domain 2 (sbd2) of abc transporter glnpq from enterococcus faecalis
34% identity, 89% coverage: 29:244/244 of query aligns to 19:237/239 of 4zefA
8eyzA Engineered glutamine binding protein bound to gln and a cobaloxime ligand (see paper)
32% identity, 86% coverage: 28:238/244 of query aligns to 5:216/226 of 8eyzA
4h5fA Crystal structure of an amino acid abc transporter substrate-binding protein from streptococcus pneumoniae canada mdr_19a bound to l- arginine, form 1
32% identity, 86% coverage: 28:237/244 of query aligns to 13:229/240 of 4h5fA
4kqpA Crystal structure of lactococcus lactis glnp substrate binding domain 2 (sbd2) in complex with glutamine at 0.95 a resolution (see paper)
29% identity, 90% coverage: 25:244/244 of query aligns to 5:227/230 of 4kqpA
3tqlA Structure of the amino acid abc transporter, periplasmic amino acid- binding protein from coxiella burnetii. (see paper)
30% identity, 89% coverage: 26:242/244 of query aligns to 2:224/225 of 3tqlA
6fxgB Crystal structure of substrate binding domain 1 (sbd1) of abc transporter glnpq in complex with asparagine
27% identity, 89% coverage: 25:242/244 of query aligns to 2:222/226 of 6fxgB
>200227 FitnessBrowser__MR1:200227
MKKSMLLGGLTLTATLLLAGCGKSEDVLVVGTNAAFPPFEYVGGQSGDEIKGFDIELAKQ
IAKDAGKTLKVENMKFDSLIVALNSGKIDFIASGMTITPERQASVNFSEPYYEATQVLLV
NKDNESIHTLDDIKDKHFAVQLGSTADMMSKKYTQKVTAFNTGFEAIMELKNGKVDLVLF
DSEPAANYLAKNPDLKLIKLDFPPEFYGFAVSKQQPELLNSINHTLKNLKENGQYQALVS
AHIK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory