SitesBLAST
Comparing 200301 FitnessBrowser__MR1:200301 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
P0A7B5 Glutamate 5-kinase; Gamma-glutamyl kinase; GK; EC 2.7.2.11 from Escherichia coli (strain K12) (see paper)
63% identity, 97% coverage: 11:371/372 of query aligns to 7:366/367 of P0A7B5
- S50 (= S54) binding
- D137 (= D141) binding
- N149 (= N153) binding
2j5tD Glutamate 5-kinase from escherichia coli complexed with glutamate (see paper)
63% identity, 97% coverage: 11:371/372 of query aligns to 5:364/365 of 2j5tD
2j5vB Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
56% identity, 97% coverage: 11:370/372 of query aligns to 5:323/325 of 2j5vB
- binding pyroglutamic acid: T11 (= T17), G49 (= G55), A50 (= A56), I51 (= I57), A52 (= A58), D135 (= D141)
- binding gamma-glutamyl phosphate: K8 (= K14), S48 (= S54), D135 (= D141), G145 (= G151), D146 (= D152), N147 (= N153)
2j5vA Glutamate 5-kinase from escherichia coli complexed with glutamyl-5- phosphate and pyroglutamic acid (see paper)
55% identity, 97% coverage: 11:370/372 of query aligns to 5:321/323 of 2j5vA
- binding magnesium ion: K8 (= K14), G10 (= G16), L166 (= L172)
- binding pyroglutamic acid: T11 (= T17), S48 (= S54), G49 (= G55), A50 (= A56), I51 (= I57)
- binding gamma-glutamyl phosphate: K8 (= K14), G10 (= G16), S48 (= S54), D135 (= D141), D146 (= D152), N147 (= N153)
2akoA Crystal structure of glutamate 5-kinase from campylobacter jejuni
37% identity, 64% coverage: 9:247/372 of query aligns to 1:226/241 of 2akoA
- binding adenosine-5'-diphosphate: H10 (≠ S18), S161 (≠ T173), D162 (= D174), I163 (≠ Q175), F166 (≠ L178), Y167 (≠ F179), N170 (≠ D182), P171 (= P183), T194 (= T215), G196 (= G217), K200 (= K221)
8j0gB Gk monomer complexes with glutamate and atp
35% identity, 67% coverage: 9:259/372 of query aligns to 8:267/274 of 8j0gB
- binding adenosine-5'-triphosphate: K13 (= K14), G15 (= G16), T16 (= T17), A17 (≠ S18), V185 (≠ Q175), G191 (≠ A181), P193 (= P183), F215 (≠ L204), R223 (≠ T215), G225 (= G217), M226 (= M218), K229 (= K221)
- binding gamma-l-glutamic acid: A55 (= A56), N147 (= N138), D150 (= D141), N163 (= N153), R223 (≠ T215)
- binding magnesium ion: R223 (≠ T215), G224 (= G216), G225 (= G217)
- binding : Y65 (= Y66), L68 (= L69), V69 (vs. gap), F73 (vs. gap)
7wx3B Gk domain of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
35% identity, 69% coverage: 4:260/372 of query aligns to 7:257/258 of 7wx3B
- binding gamma-glutamyl phosphate: S59 (= S54), A61 (= A56), N149 (= N138), T150 (≠ E139), D152 (= D141), M158 (≠ E147), N165 (= N153)
- binding : E72 (≠ P67), M75 (≠ P70), L77 (≠ T72), S78 (≠ M73), M79 (≠ A74), R80 (≠ N75)
7f5xA Gk domain of drosophila p5cs filament with glutamate (see paper)
34% identity, 69% coverage: 4:260/372 of query aligns to 7:235/236 of 7f5xA
8j0eB Gk monomer complexes with catalytic intermediate
34% identity, 67% coverage: 9:259/372 of query aligns to 11:262/269 of 8j0eB
- binding magnesium ion: D163 (= D154), G219 (= G216)
- binding (2~{R})-5-[[[[(2~{R},3~{S},4~{S},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-oxidanyl-phosphoryl]oxy-2-azanyl-5-oxidanylidene-pentanoic acid: K16 (= K14), G18 (= G16), T19 (= T17), A20 (≠ S18), S56 (= S54), G57 (= G55), V59 (≠ I57), D153 (= D141), N162 (= N153), V184 (≠ Q175), P192 (= P183), K217 (≠ G214), R218 (≠ T215), G219 (= G216), G220 (= G217), M221 (= M218)
- binding : Y68 (= Y66), L71 (= L69), V72 (vs. gap), V72 (vs. gap), S74 (vs. gap), F76 (vs. gap), F76 (vs. gap), Q80 (vs. gap)
8j0fA Gk tetramer with adjacent hooks at reaction state
34% identity, 67% coverage: 9:259/372 of query aligns to 12:261/270 of 8j0fA
- binding adenosine-5'-diphosphate: A21 (≠ S18), D183 (= D174), V184 (≠ Q175), Y188 (≠ F179), G190 (≠ A181), F214 (≠ L204), G219 (= G217), M220 (= M218)
- binding magnesium ion: R217 (≠ T215), G218 (= G216), G219 (= G217)
- binding gamma-glutamyl phosphate: K17 (= K14), T20 (= T17), S57 (= S54), D154 (= D141), N162 (= N153), R217 (≠ T215)
- binding : L72 (= L69), V73 (vs. gap), N74 (vs. gap), S75 (vs. gap), S76 (vs. gap), F77 (vs. gap), F77 (vs. gap), A78 (vs. gap), L80 (vs. gap)
7lnuB Ternary complex of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus bound to isopentenyl monophosphate and atp (see paper)
23% identity, 66% coverage: 11:255/372 of query aligns to 5:252/261 of 7lnuB
- binding adenosine-5'-diphosphate: K8 (= K14), S12 (= S18), S172 (≠ T173), D173 (= D174), I174 (≠ Q175), Y178 (≠ F179), A180 (= A181), K183 (≠ R184), K218 (= K221)
- binding Isopentenyl phosphate: A48 (vs. gap), G52 (vs. gap), H53 (vs. gap), I149 (≠ V150), S151 (≠ D152), G152 (≠ N153)
7lntB Ternary complex of the isopentenyl phosphate kinase from candidatus methanomethylophilus alvus bound to benzyl monophosphate and atp (see paper)
23% identity, 66% coverage: 11:255/372 of query aligns to 4:251/260 of 7lntB
- binding adenosine-5'-diphosphate: G9 (= G16), G10 (≠ T17), S11 (= S18), D172 (= D174), I173 (≠ Q175), Y177 (≠ F179), D180 (= D182)
- binding (phenylmethyl) dihydrogen phosphate: A47 (vs. gap), G51 (vs. gap), H52 (vs. gap), I148 (≠ V150), S150 (≠ D152)
2bmuB Ump kinase from pyrococcus furiosus complexed with its substrate ump and its substrate analog amppnp (see paper)
31% identity, 23% coverage: 153:237/372 of query aligns to 121:202/226 of 2bmuB
- binding phosphoaminophosphonic acid-adenylate ester: T141 (= T173), N142 (≠ D174), V146 (≠ L178), Y147 (≠ F179), A149 (= A181), D150 (= D182), P151 (= P183), S182 (≠ G216), S183 (≠ G217), V184 (≠ M218)
- binding magnesium ion: D122 (= D154), D122 (= D154), S183 (≠ G217), V184 (≠ M218)
- binding uridine-5'-monophosphate: T121 (≠ N153), A179 (≠ L213)
Sites not aligning to the query:
- binding phosphoaminophosphonic acid-adenylate ester: 9, 10, 44, 45, 46
- binding magnesium ion: 7
- binding uridine-5'-monophosphate: 44, 45, 67, 70, 71, 114, 115, 116, 119, 120
Q8U122 Uridylate kinase; UK; Uridine monophosphate kinase; UMP kinase; UMPK; EC 2.7.4.22 from Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) (see paper)
31% identity, 23% coverage: 153:237/372 of query aligns to 120:201/225 of Q8U122
- T120 (≠ N153) binding
- D121 (= D154) binding ; binding
- G179 (= G214) binding
- S182 (≠ G217) binding
Sites not aligning to the query:
- 6 binding
- 44 binding
- 66 binding
- 114:120 binding
Query Sequence
>200301 FitnessBrowser__MR1:200301
MNLSEIAYRRVVVKLGTSVLTSGSKQLDKAHMVELARQMAALMRSGVEVVLCTSGAIAAG
REHLQYPALPDTMANKQLLAAVGQSQLILAWAQLFSIYGLHVGQLLLTRADLHDRERYLN
ARDTLNALLANNIIPIINENDAVATNEIKVGDNDNLSARAALLCDADLLILLTDQKGLFD
ADPRTNPNAKLISQVEKIDDSLRLLAGGSVSGLGTGGMSTKLEAADIARRAGIEVVIASG
HHPDVIKKVVAKESIGTHFSAIENPLESRKQWILAGPAAQGSLVLDAGAVKAVTEKGRSL
LSKGIIGVKGEFERGATLQLVDQNGKIIARGITRYCGEALGLIAGKHSDEIESVLGYDYG
DAIVHRNDMVVL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory