Comparing 200396 FitnessBrowser__MR1:200396 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 17 hits to proteins with known functional sites (download)
4yyyB X-ray structure of the thymidine phosphorylase from salmonella typhimurium in complex with uridine (see paper)
68% identity, 99% coverage: 1:438/443 of query aligns to 1:438/440 of 4yyyB
4yekA X-ray structure of the thymidine phosphorylase from salmonella typhimurium in complex with thymidine (see paper)
68% identity, 99% coverage: 1:438/443 of query aligns to 1:438/440 of 4yekA
5ey3A X-ray structure of the thymidine phosphorylase from salmonella typhimurium in complex with cytidine and sulphate
68% identity, 99% coverage: 1:438/443 of query aligns to 3:440/442 of 5ey3A
4lhmA Thymidine phosphorylase from e.Coli with 3'-azido-3'-deoxythymidine (see paper)
67% identity, 99% coverage: 1:438/443 of query aligns to 1:438/440 of 4lhmA
Sites not aligning to the query:
4eadA Thymidine phosphorylase from e.Coli with 3'-azido-2'-fluoro- dideoxyuridine
67% identity, 99% coverage: 1:438/443 of query aligns to 1:438/440 of 4eadA
5olnB X-ray structure of the complex pyrimidine-nucleoside phosphorylase from bacillus subtilis at 1.88 a (see paper)
43% identity, 94% coverage: 6:420/443 of query aligns to 6:419/434 of 5olnB
1brwB The crystal structure of pyrimidine nucleoside phosphorylase in a closed conformation (see paper)
40% identity, 98% coverage: 6:438/443 of query aligns to 5:432/433 of 1brwB
1brwA The crystal structure of pyrimidine nucleoside phosphorylase in a closed conformation (see paper)
40% identity, 98% coverage: 6:438/443 of query aligns to 5:432/433 of 1brwA
7m7kB Crystal structure of uridine bound to geobacillus thermoglucosidasius pyrimidine nucleoside phosphorylase pynp
41% identity, 98% coverage: 6:438/443 of query aligns to 4:431/432 of 7m7kB
P77836 Pyrimidine-nucleoside phosphorylase; PYNP; Py-NPase; EC 2.4.2.2 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
39% identity, 94% coverage: 6:422/443 of query aligns to 5:412/433 of P77836
2j0fA Structural basis for non-competitive product inhibition in human thymidine phosphorylase: implication for drug design (see paper)
37% identity, 98% coverage: 6:438/443 of query aligns to 5:443/446 of 2j0fA
2wk6A Structural features of native human thymidine phosphorylase and in complex with 5-iodouracil (see paper)
37% identity, 98% coverage: 6:438/443 of query aligns to 4:442/446 of 2wk6A
P19971 Thymidine phosphorylase; TP; Gliostatin; Platelet-derived endothelial cell growth factor; PD-ECGF; TdRPase; EC 2.4.2.4 from Homo sapiens (Human) (see 3 papers)
37% identity, 98% coverage: 6:438/443 of query aligns to 38:476/482 of P19971
1uouA Crystal structure of human thymidine phosphorylase in complex with a small molecule inhibitor (see paper)
37% identity, 98% coverage: 6:438/443 of query aligns to 6:434/438 of 1uouA
4ga6A Crystal structure of amp phosphorylasE C-terminal deletion mutant in complex with substrates (see paper)
27% identity, 92% coverage: 8:413/443 of query aligns to 91:480/493 of 4ga6A
4ga4A Crystal structure of amp phosphorylase n-terminal deletion mutant (see paper)
27% identity, 92% coverage: 8:413/443 of query aligns to 7:396/418 of 4ga4A
Q5JCX3 AMP phosphorylase; AMPpase; Nucleoside monophosphate phosphorylase; NMP phosphorylase; EC 2.4.2.57 from Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) (Pyrococcus kodakaraensis (strain KOD1)) (see paper)
27% identity, 92% coverage: 8:413/443 of query aligns to 91:480/503 of Q5JCX3
>200396 FitnessBrowser__MR1:200396
MFLAQEIIRKKRNGLVLSAEEIQFFVKGITTNAVSEGQIAALGMAVYFNDMNMDERIALT
TAMRDSGTVLNWQSLNLNGPVIDKHSTGGVGDVISLMLGPMAAACGGYVPMISGRGLGHT
GGTLDKFDAIPGYQTEPSSELFRKVVKDVGVAIIGQTGDLVPADKRFYSIRDNTATVESI
SLITASILSKKLACSLDALAMDVKVGSGAFMPTYEASEELARSIAAVANGAGTKTTALLT
DMNQVLASCAGNALEVKEAIDFLTGAYRNPRLYAVTMGLCAEMLLLGGLATDEADARAKL
NRVLDNGRAAEIFGKMVSGLGGPVDFVENYSKYLPQSQIIRPVFADTQGYAHSMDTRELG
LAVVTLGGGRRKPGDELDYSVGLTQVCALGDKIDASTPIAVIHAQSEEAFAQAEDAVKKA
IHIDEIAPEKTPEIYAYIRATDL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory