SitesBLAST
Comparing 200539 FitnessBrowser__MR1:200539 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6laaA Crystal structure of full-length cyp116b46 from tepidiphilus thermophilus (see paper)
23% identity, 97% coverage: 5:319/325 of query aligns to 470:747/753 of 6laaA
- binding fe2/s2 (inorganic) cluster: S700 (≠ A272), C702 (= C274), E703 (≠ R275), G705 (= G277), C707 (= C279), G708 (= G280), C710 (= C282), C740 (= C312)
- binding flavin mononucleotide: R487 (= R24), Q488 (≠ S25), Y489 (= Y26), S490 (≠ T27), Q506 (≠ K43), S511 (≠ V45), R512 (≠ D46), G514 (= G48), S515 (= S51), I553 (≠ C90), E651 (≠ N207), F653 (≠ L209)
Sites not aligning to the query:
- active site: 177, 251, 252, 359, 360, 361
- binding carbonate ion: 90, 91, 92, 241
- binding protoporphyrin ix containing fe: 54, 91, 92, 99, 103, 249, 252, 253, 298, 351, 352, 353, 357, 359, 361
1gvhA The x-ray structure of ferric escherichia coli flavohemoglobin reveals an unespected geometry of the distal heme pocket (see paper)
26% identity, 65% coverage: 4:215/325 of query aligns to 182:391/396 of 1gvhA
- binding flavin-adenine dinucleotide: Y188 (≠ F10), R204 (= R24), Q205 (≠ S25), Y206 (= Y26), S207 (≠ T27), A220 (≠ T41), V221 (≠ I42), E224 (≠ V45), G227 (= G48), Q228 (≠ L49), V229 (= V50), S230 (= S51), V269 (≠ C90), T272 (= T93), E388 (= E212), F390 (= F214)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 48, 50
- binding protoporphyrin ix containing fe: 43, 53, 56, 57, 60, 61, 81, 84, 85, 90, 94, 95, 127, 131, 393
P24232 Flavohemoprotein; Flavohemoglobin; HMP; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Escherichia coli (strain K12) (see 2 papers)
26% identity, 65% coverage: 4:215/325 of query aligns to 182:391/396 of P24232
Sites not aligning to the query:
- 29 mutation Y->E,H: 15 to 35-fold reduction in NO dioxygenase activity.; Y→F: 30-fold reduction in NO dioxygenase activity, and 80-fold increase in the O(2) dissociation rate constant.
- 95 active site, Charge relay system
- 135 active site, Charge relay system
6kbhA Crystal structure of an intact type iv self-sufficient cytochrome p450 monooxygenase
25% identity, 95% coverage: 15:324/325 of query aligns to 490:765/765 of 6kbhA
- binding fe2/s2 (inorganic) cluster: C714 (= C274), E715 (≠ R275), G717 (= G277), C719 (= C279), G720 (= G280), C722 (= C282), C752 (≠ A311)
- binding flavin mononucleotide: R499 (= R24), Q500 (≠ S25), Y501 (= Y26), S502 (≠ T27), A516 (≠ T41), L518 (vs. gap), S523 (≠ V45), R524 (≠ D46), G526 (= G48), S527 (= S51), I565 (≠ C90), T568 (= T93), E663 (= E212), F665 (= F214), I718 (≠ V278)
Sites not aligning to the query:
- active site: 190, 264, 265, 372, 373, 374
- binding protoporphyrin ix containing fe: 67, 104, 105, 112, 116, 261, 262, 265, 266, 308, 311, 313, 364, 365, 370, 372, 373, 374, 378
3ozwA The crystal structure of flavohemoglobin from r. Eutrophus in complex with ketoconazole (see paper)
26% identity, 65% coverage: 4:215/325 of query aligns to 184:397/403 of 3ozwA
- binding flavin-adenine dinucleotide: R206 (= R24), Q207 (≠ S25), Y208 (= Y26), S209 (≠ T27), S222 (≠ T41), V223 (≠ I42), K224 (= K43), E226 (≠ V45), P232 (vs. gap), G234 (vs. gap), Y235 (≠ L49), V236 (= V50), S237 (= S51), V276 (≠ C90), T279 (= T93), V395 (≠ S213), F396 (= F214)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 50
- binding protoporphyrin ix containing fe: 42, 43, 81, 85, 88, 90, 94, 95, 98, 126, 130, 133
- binding 1-acetyl-4-(4-{[(2R,4S)-2-(2,4-dichlorophenyl)-2-(1H-imidazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy}phenyl)piperazine: 53, 56, 102, 398
3ozvA The crystal structure of flavohemoglobin from r. Eutrophus in complex with econazole (see paper)
26% identity, 65% coverage: 4:215/325 of query aligns to 184:397/403 of 3ozvA
- binding flavin-adenine dinucleotide: R206 (= R24), Q207 (≠ S25), Y208 (= Y26), S209 (≠ T27), S222 (≠ T41), V223 (≠ I42), K224 (= K43), E226 (≠ V45), P232 (vs. gap), G234 (vs. gap), Y235 (≠ L49), V236 (= V50), S237 (= S51), V276 (≠ C90), T279 (= T93), F396 (= F214)
Sites not aligning to the query:
- binding 1-[(2s)-2-[(4-chlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1h-imidazole: 24, 28, 57, 102, 106
- binding flavin-adenine dinucleotide: 44, 46, 48
- binding protoporphyrin ix containing fe: 43, 81, 84, 85, 88, 90, 94, 95, 98, 126, 130, 133
3ozuA The crystal structure of flavohemoglobin from r. Eutrophus in complex with miconazole (see paper)
26% identity, 65% coverage: 4:215/325 of query aligns to 184:397/403 of 3ozuA
- binding flavin-adenine dinucleotide: R206 (= R24), Q207 (≠ S25), Y208 (= Y26), S209 (≠ T27), S222 (≠ T41), V223 (≠ I42), K224 (= K43), E226 (≠ V45), P232 (vs. gap), G234 (vs. gap), Y235 (≠ L49), V236 (= V50), S237 (= S51), E394 (= E212), V395 (≠ S213), G397 (≠ A215)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 47, 398
- binding protoporphyrin ix containing fe: 43, 44, 81, 85, 88, 90, 94, 95, 98, 126, 129, 130, 133
- binding 1-[(2R)-2-[(2,4-dichlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1H-imidazole: 25, 28, 43, 56, 57, 102, 122, 125, 126
P39662 Flavohemoprotein; FHP; Flavohemoglobin; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see paper)
26% identity, 65% coverage: 4:215/325 of query aligns to 184:397/403 of P39662
Sites not aligning to the query:
- 60 A→Y: Does not affect phospholipid-binding.
- 98 V→F: Blocks phospholipid-binding.
1cqxA Crystal structure of the flavohemoglobin from alcaligenes eutrophus at 1.75 a resolution (see paper)
26% identity, 65% coverage: 4:215/325 of query aligns to 184:397/403 of 1cqxA
- binding flavin-adenine dinucleotide: Y190 (≠ F10), R206 (= R24), Q207 (≠ S25), Y208 (= Y26), S209 (≠ T27), S222 (≠ T41), E226 (≠ V45), Q231 (vs. gap), P232 (vs. gap), G234 (vs. gap), Y235 (≠ L49), V236 (= V50), S237 (= S51), V395 (≠ S213), G397 (≠ A215)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 47, 398
- binding protoporphyrin ix containing fe: 43, 44, 81, 85, 88, 90, 94, 95, 98, 126, 129, 130, 133
2eixA The structure of physarum polycephalum cytochrome b5 reductase (see paper)
26% identity, 61% coverage: 8:204/325 of query aligns to 45:235/243 of 2eixA
- active site: H47 (≠ F10), Y63 (= Y26), T64 (= T27), C217 (= C186)
- binding flavin-adenine dinucleotide: R61 (= R24), P62 (≠ S25), Y63 (= Y26), T64 (= T27), I78 (≠ T41), Y82 (≠ V45), K84 (≠ G47), G85 (= G48), M87 (≠ V50), S88 (= S51), T126 (≠ C90), T129 (= T93), F195 (≠ R165), M221 (≠ L190), A225 (= A194)
P0DPQ8 Aromatic O-demethylase, reductase subunit; NADH--hemoprotein reductase; EC 1.6.2.- from Amycolatopsis sp. (strain ATCC 39116 / 75iv2) (see paper)
22% identity, 66% coverage: 5:217/325 of query aligns to 128:333/334 of P0DPQ8
Sites not aligning to the query:
- 35 binding
- 40 binding
- 43 binding
- 75 binding
- 334 binding
5ogxA Crystal structure of amycolatopsis cytochrome p450 reductase gcob. (see paper)
22% identity, 66% coverage: 5:217/325 of query aligns to 127:332/333 of 5ogxA
- binding flavin-adenine dinucleotide: Y132 (≠ F10), R144 (= R24), Q145 (≠ S25), Y146 (= Y26), S147 (≠ T27), H161 (≠ T41), V162 (≠ I42), V165 (= V45), G168 (= G48), V169 (≠ L49), A170 (≠ V50), T171 (≠ S51), T214 (≠ C90), F329 (= F214), P331 (≠ T216)
Sites not aligning to the query:
4eh1A Crystal structure of the flavohem-like-fad/NAD binding domain of nitric oxide dioxygenase from vibrio cholerae o1 biovar el tor
26% identity, 66% coverage: 3:215/325 of query aligns to 32:236/237 of 4eh1A
- binding flavin-adenine dinucleotide: Y39 (≠ F10), R55 (= R24), Q56 (≠ S25), Y57 (= Y26), S58 (≠ T27), S71 (≠ M39), V72 (= V40), E75 (≠ K43), N81 (≠ D46), G83 (= G48), L84 (= L49), V85 (= V50), S86 (= S51), T127 (= T93), E233 (= E212), F235 (= F214)
1tvcA Fad and nadh binding domain of methane monooxygenase reductase from methylococcus capsulatus (bath) (see paper)
23% identity, 65% coverage: 5:214/325 of query aligns to 44:244/250 of 1tvcA
- active site: Y63 (= Y26), S64 (≠ T27), L215 (= L185)
- binding dihydroflavine-adenine dinucleotide: F49 (= F10), R61 (= R24), S62 (= S25), Y63 (= Y26), S64 (≠ T27), L78 (≠ T41), I79 (= I42), R80 (≠ K43), L82 (≠ V45), F87 (≠ V50), G128 (= G91), N155 (≠ R118), E159 (≠ D122), S186 (≠ A159), G187 (≠ F160), E242 (= E212), F244 (= F214)
Sites not aligning to the query:
P17571 Nitrate reductase [NADH] 1; NR; EC 1.7.1.1 from Zea mays (Maize) (see 3 papers)
27% identity, 61% coverage: 8:206/325 of query aligns to 397:614/621 of P17571
- RAYT 413:416 (≠ RSYT 24:27) binding
- LVK 430:432 (≠ MVT 39:41) binding
- F435 (vs. gap) binding
- LMT 447:449 (≠ LVS 49:51) binding
- S497 (≠ C90) binding
- T500 (= T93) binding
- C593 (= C186) Necessary for efficient electron Transfer; mutation to S: Reduction of activity.
1cnfA Structural studies on corn nitrate reductase: refined structure of the cytochrome b reductase fragment at 2.5 angstroms, its adp complex and an active site mutant and modeling of the cytochrome b domain (see paper)
27% identity, 61% coverage: 8:206/325 of query aligns to 36:253/260 of 1cnfA
- active site: H38 (≠ F10), Y54 (= Y26), T55 (= T27), C232 (= C186)
- binding adenosine-5'-diphosphate: K71 (≠ T41), N165 (≠ A117), P234 (= P188), P236 (≠ L190), M237 (≠ Y191), F240 (vs. gap), A241 (= A194)
- binding flavin-adenine dinucleotide: R52 (= R24), A53 (≠ S25), Y54 (= Y26), L69 (≠ M39), Y73 (vs. gap), F81 (≠ R44), G84 (= G47), G85 (= G48), L86 (= L49), M87 (≠ V50), T88 (≠ S51), S136 (≠ C90), T139 (= T93), P140 (= P94)
6iriA Crystal structure of the minor ferredoxin from thermosynechococcus elongatus (see paper)
33% identity, 21% coverage: 255:323/325 of query aligns to 28:96/107 of 6iriA
6rraA X-ray structure of the ferredoxin-NADP reductase from brucella ovis in complex with NADP (see paper)
27% identity, 62% coverage: 3:204/325 of query aligns to 30:237/257 of 6rraA
- binding flavin-adenine dinucleotide: F37 (= F10), R51 (= R24), A52 (≠ S25), Y53 (= Y26), S54 (≠ T27), S68 (≠ T41), I69 (= I42), G74 (= G47), P75 (≠ G48), L76 (= L49), T77 (≠ V50), T117 (≠ C90)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V144 (≠ A117), R145 (= R118), T181 (= T156), R182 (≠ E157), R190 (= R165), T192 (vs. gap), S221 (≠ P188), P222 (≠ E189), E223 (≠ L190), M224 (≠ Y191)
Sites not aligning to the query:
6rr3A Crystal structure of fad-containing ferredoxin-NADP reductase from brucella ovis (see paper)
27% identity, 62% coverage: 3:204/325 of query aligns to 30:237/257 of 6rr3A
- binding flavin-adenine dinucleotide: F37 (= F10), R51 (= R24), A52 (≠ S25), Y53 (= Y26), S54 (≠ T27), F67 (≠ V40), S68 (≠ T41), I69 (= I42), G74 (= G47), P75 (≠ G48), L76 (= L49), T77 (≠ V50), T117 (≠ C90)
Sites not aligning to the query:
1cneA Structural studies on corn nitrate reductase: refined structure of the cytochrome b reductase fragment at 2.5 angstroms, its adp complex and an active site mutant and modeling of the cytochrome b domain (see paper)
27% identity, 61% coverage: 8:206/325 of query aligns to 36:253/260 of 1cneA
- active site: H38 (≠ F10), Y54 (= Y26), T55 (= T27), S232 (vs. gap)
- binding flavin-adenine dinucleotide: R52 (= R24), A53 (≠ S25), Y54 (= Y26), L69 (≠ M39), V70 (= V40), Y73 (vs. gap), H78 (vs. gap), G84 (= G47), M87 (≠ V50), T88 (≠ S51)
Sites not aligning to the query:
Query Sequence
>200539 FitnessBrowser__MR1:200539
MKFDYKPGQFITFVLEINGEQACRSYTLSSTPSRPYSLMVTIKRVDGGLVSNYLIDHLQP
GQTVRVLPPTGQFNLFDIPANKYLFLSAGCGITPMYSMSRYLTDTQINADIAVVHSARTQ
ADIIFKNTLETMAARHASFKLCYLVEGVTTDTVWHTEEAFHYVGRLSAQNLLSLVPDFAE
RIVFLCGPELYMQAVKTILTELNFDMNKLYHESFATAVKEAQSHVKQAEIQSETPTTSST
GFMLSIGDKKHLLTAEQTLLDGIEAEGLPIIAACRSGVCGACKCKVLQGETESTSYMTLT
PTDIEAGYVLACSTRLKSDVTLSLI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory