Comparing 200564 FitnessBrowser__MR1:200564 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 3 hits to proteins with known functional sites (download)
6jdcA Crystal structure of n-acetyl mannosmaine kinase in complex with mannac from haemophilus influenzae
26% identity, 67% coverage: 1:176/264 of query aligns to 1:191/269 of 6jdcA
6jdbA Crystal structure of n-acetyl mannosmaine kinase in complex with mannac-6p and adp from haemophilus influenzae
27% identity, 56% coverage: 1:147/264 of query aligns to 1:155/290 of 6jdbA
Sites not aligning to the query:
2gupA Structural genomics, the crystal structure of a rok family protein from streptococcus pneumoniae tigr4 in complex with sucrose
31% identity, 64% coverage: 1:169/264 of query aligns to 1:174/289 of 2gupA
Sites not aligning to the query:
>200564 FitnessBrowser__MR1:200564
MQTLTIDVGGSKALFELQLKGHTEQYKIPTGEGFKIEDLNNQIAALERDYDLQHYHLAIA
VPGLVQQNRLVSCKSLPGLNGLSFDTLKTQGQLKFICNDIDAGMQATCDEKYACELLVMC
GTGIGMSIAFNGKAFTGATGVAGELGHCRVMTESGEFSLEQLASGDSIRSRKISTADDLY
RSGTYLGMGLAWAVNLFNPNRIWLAGGMMNSAPYYKGCLDSLRRMALSAPLAEMKINRVD
DMETLVCRGLSVILARDFSDKADL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory