Comparing 200579 FitnessBrowser__MR1:200579 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
2b33B Crystal structure of a putative endoribonuclease (tm0215) from thermotoga maritima msb8 at 2.30 a resolution
48% identity, 95% coverage: 3:124/128 of query aligns to 1:122/126 of 2b33B
7cd4A Crystal structure of the s103f mutant of bacillus subtilis (natto) yabj protein. (see paper)
47% identity, 95% coverage: 6:126/128 of query aligns to 4:123/124 of 7cd4A
2uynA Crystal structure of e. Coli tdcf with bound 2-ketobutyrate (see paper)
45% identity, 95% coverage: 3:124/128 of query aligns to 1:124/127 of 2uynA
2uykC Crystal structure of e. Coli tdcf with bound serine (see paper)
45% identity, 95% coverage: 3:124/128 of query aligns to 1:124/127 of 2uykC
P52759 2-iminobutanoate/2-iminopropanoate deaminase; Liver perchloric acid-soluble protein; L-PSP; Reactive intermediate imine deaminase A homolog; Translation inhibitor L-PSP ribonuclease; UK114 antigen homolog; rp14.5; EC 3.5.99.10 from Rattus norvegicus (Rat) (see paper)
42% identity, 97% coverage: 1:124/128 of query aligns to 4:127/137 of P52759
Sites not aligning to the query:
P80601 2-iminobutanoate/2-iminopropanoate deaminase; 14.3 kDa perchloric acid soluble protein; Translation inhibitor L-PSP ribonuclease; UK114 antigen; EC 3.5.99.10; EC 3.1.-.- from Capra hircus (Goat) (see paper)
44% identity, 97% coverage: 1:124/128 of query aligns to 4:127/137 of P80601
Sites not aligning to the query:
Q94JQ4 Reactive Intermediate Deaminase A, chloroplastic; 2-iminobutanoate/2-iminopropanoate deaminase; EC 3.5.99.10 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
40% identity, 97% coverage: 3:126/128 of query aligns to 64:187/187 of Q94JQ4
Q7CP78 2-iminobutanoate/2-iminopropanoate deaminase; Enamine/imine deaminase; EC 3.5.99.10 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
44% identity, 96% coverage: 2:124/128 of query aligns to 1:125/128 of Q7CP78
5v4dA Crystal structure of the protein of unknown function of the conserved rid protein family yyfa from yersinia pestis
42% identity, 97% coverage: 3:126/128 of query aligns to 3:127/127 of 5v4dA
3k0tC Crystal structure of pspto -psp protein in complex with d-beta-glucose from pseudomonas syringae pv. Tomato str. Dc3000 (see paper)
40% identity, 95% coverage: 3:123/128 of query aligns to 1:120/124 of 3k0tC
3vczB 1.80 angstrom resolution crystal structure of a putative translation initiation inhibitor from vibrio vulnificus cmcp6
43% identity, 94% coverage: 5:124/128 of query aligns to 3:125/127 of 3vczB
A0A1J1DL12 2-iminobutanoate/2-iminopropanoate deaminase; Allergen Der f 34; Enamine/imine deaminase; Allergen Der f 34.0101; EC 3.5.99.10 from Dermatophagoides farinae (American house dust mite) (see paper)
38% identity, 95% coverage: 3:123/128 of query aligns to 4:124/128 of A0A1J1DL12
Sites not aligning to the query:
5hp8A Crystal structures of rida in complex with pyruvate (see paper)
39% identity, 84% coverage: 19:126/128 of query aligns to 1:108/108 of 5hp8A
P0AFQ5 3-aminoacrylate deaminase RutC; 3-AA deaminase; EC 3.5.-.- from Escherichia coli (strain K12) (see paper)
28% identity, 98% coverage: 1:126/128 of query aligns to 1:126/128 of P0AFQ5
3i3fA Hypothetical protein from giardia lamblia gl50803_14299
32% identity, 64% coverage: 39:120/128 of query aligns to 38:123/131 of 3i3fA
Sites not aligning to the query:
3i3fB Hypothetical protein from giardia lamblia gl50803_14299
32% identity, 64% coverage: 39:120/128 of query aligns to 35:120/128 of 3i3fB
Sites not aligning to the query:
>200579 FitnessBrowser__MR1:200579
MMKSIIHAERAPTAIGPYSHGTRYGNLIFTSGQLPVCKDKGGVVDGGISEQSVQCLENLK
YVLEAGGGSLDTVLKTTCYLSEISDFAAFNEVYKTYFKTDCPARSCFAVKDLPLGVKVEI
EAIAHVND
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory