SitesBLAST
Comparing 200692 FitnessBrowser__MR1:200692 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
22% identity, 52% coverage: 22:494/914 of query aligns to 45:460/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ F50), G75 (≠ A52), S76 (≠ A53), G77 (= G54), T78 (= T55), G79 (≠ S56), L80 (= L57), A83 (≠ Q60), C84 (≠ A61), P137 (= P113), G138 (≠ A114), E139 (≠ T115), A142 (= A119), T143 (≠ K120), G146 (= G123), N147 (≠ I124), S149 (≠ A126), T150 (≠ N127), A152 (= A129), G153 (≠ S130), E203 (= E231), G204 (= G232), I209 (= I237), E422 (= E456), H423 (= H457)
- binding fe (iii) ion: H377 (= H411), H384 (= H418), E422 (= E456)
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
22% identity, 54% coverage: 4:498/914 of query aligns to 22:465/465 of 3pm9A
- active site: A149 (= A129), L159 (≠ D153)
- binding flavin-adenine dinucleotide: P69 (≠ F50), Q70 (≠ R51), G71 (≠ A52), G72 (≠ A53), N73 (≠ G54), T74 (= T55), G75 (≠ S56), L76 (= L57), G79 (≠ Q60), Q80 (≠ A61), L91 (≠ I69), L133 (≠ P113), G134 (≠ A114), A135 (≠ T115), C139 (≠ A119), T140 (≠ K120), G142 (= G122), G143 (= G123), S146 (≠ A126), T147 (≠ N127), A149 (= A129), G150 (≠ S130), E200 (= E231), G201 (= G232), I205 (≠ F236), I206 (= I237), E423 (= E456)
P39976 D-2-hydroxyglutarate--pyruvate transhydrogenase DLD3; D-2HG--pyruvate transhydrogenase DLD3; (R)-2-hydroxyglutarate--pyruvate transhydrogenase; D-lactate dehydrogenase [cytochrome] 3; D-lactate ferricytochrome C oxidoreductase; D-LCR; EC 1.1.99.40; EC 1.1.2.4 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
26% identity, 31% coverage: 210:494/914 of query aligns to 207:492/496 of P39976
Sites not aligning to the query:
- 17 modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
8jdxA Crystal structure of mldhd in complex with 2-ketoisovaleric acid (see paper)
24% identity, 33% coverage: 197:498/914 of query aligns to 179:455/455 of 8jdxA
- binding flavin-adenine dinucleotide: E200 (= E231), G201 (= G232), I206 (= I237), W322 (≠ F362), E413 (= E456), H414 (= H457), N450 (= N493)
- binding 3-methyl-2-oxobutanoic acid: R318 (= R358), H369 (= H411), H376 (= H418), H414 (= H457)
- binding manganese (ii) ion: H369 (= H411), H376 (= H418), E413 (= E456)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 32, 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147
8jdsA Crystal structure of mldhd in complex with pyruvate (see paper)
24% identity, 33% coverage: 197:498/914 of query aligns to 179:456/456 of 8jdsA
- binding flavin-adenine dinucleotide: E200 (= E231), G201 (= G232), I206 (= I237), W323 (≠ F362), E414 (= E456), H415 (= H457), N451 (= N493)
- binding manganese (ii) ion: H370 (= H411), H377 (= H418), E414 (= E456)
- binding pyruvic acid: R319 (= R358), H370 (= H411), H377 (= H418), H415 (= H457)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 32, 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147
8jdzA Crystal structure of mldhd in complex with 2-keto-3-methylvaleric acid (see paper)
24% identity, 33% coverage: 197:498/914 of query aligns to 179:454/454 of 8jdzA
- binding (3S)-3-methyl-2-oxopentanoic acid: R318 (= R358), W322 (≠ F362), H369 (= H411), H376 (= H418), H413 (= H457)
- binding flavin-adenine dinucleotide: E200 (= E231), G201 (= G232), I206 (= I237), W322 (≠ F362), E412 (= E456), H413 (= H457), N449 (= N493)
- binding manganese (ii) ion: H369 (= H411), H376 (= H418), E412 (= E456)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 32, 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147
8jdyA Crystal structure of mldhd in complex with 2-ketoisocaproic acid (see paper)
24% identity, 33% coverage: 197:498/914 of query aligns to 179:454/454 of 8jdyA
- binding 2-oxo-4-methylpentanoic acid: R318 (= R358), W322 (≠ F362), S336 (≠ I377), H369 (= H411), H376 (= H418), H413 (= H457)
- binding flavin-adenine dinucleotide: E200 (= E231), G201 (= G232), I206 (= I237), E412 (= E456), N449 (= N493)
- binding manganese (ii) ion: H369 (= H411), H376 (= H418), E412 (= E456)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147
8jdeA Crystal structure of mldhd in complex with d-lactate (see paper)
24% identity, 33% coverage: 197:498/914 of query aligns to 179:455/455 of 8jdeA
- binding flavin-adenine dinucleotide: E200 (= E231), G201 (= G232), I206 (= I237), W322 (= W355), E413 (= E456), H414 (= H457), N450 (= N493)
- binding lactic acid: R318 (≠ Y351), H369 (= H411), H376 (= H418), H414 (= H457)
- binding manganese (ii) ion: H369 (= H411), H376 (= H418), E413 (= E456)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147
8jdvA Crystal structure of mldhd in complex with 2-ketohexanoic acid (see paper)
24% identity, 33% coverage: 197:498/914 of query aligns to 179:454/454 of 8jdvA
- binding 2-Ketohexanoic acid: R317 (= R358), W321 (≠ F362), H368 (= H411), H375 (= H418), H413 (= H457)
- binding flavin-adenine dinucleotide: E200 (= E231), G201 (= G232), I206 (= I237), W321 (≠ F362), Y322 (≠ P363), E412 (= E456), H413 (= H457), N449 (= N493)
- binding manganese (ii) ion: H368 (= H411), H375 (= H418), E412 (= E456)
Sites not aligning to the query:
- binding 2-Ketohexanoic acid: 75
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147
8jduA Crystal structure of mldhd in complex with 2-ketovaleric acid (see paper)
23% identity, 33% coverage: 197:498/914 of query aligns to 179:455/455 of 8jduA
- binding 2-oxopentanoic acid: R318 (= R358), W322 (≠ F362), H369 (= H411), H376 (= H418), H414 (= H457)
- binding flavin-adenine dinucleotide: E200 (= E231), G201 (= G232), I206 (= I237), W322 (≠ F362), E413 (= E456), N450 (= N493)
- binding manganese (ii) ion: H369 (= H411), H376 (= H418), E413 (= E456)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
22% identity, 54% coverage: 5:494/914 of query aligns to 1:461/467 of 6lpnB
- binding flavin-adenine dinucleotide: W40 (vs. gap), P76 (≠ F50), G78 (≠ A52), G79 (≠ A53), N80 (≠ G54), T81 (= T55), G82 (≠ S56), M83 (≠ L57), G86 (≠ Q60), S87 (≠ A61), L140 (≠ P113), A142 (≠ T115), C146 (≠ A119), H147 (≠ K120), G150 (= G123), N151 (≠ I124), A153 (= A126), T154 (≠ N127), G208 (= G232), I212 (≠ F236), I213 (= I237), E423 (= E456), N460 (= N493)
8jdtA Crystal structure of mldhd in complex with 2-ketobutanoic acid (see paper)
23% identity, 33% coverage: 197:498/914 of query aligns to 179:455/455 of 8jdtA
- binding 2-ketobutyric acid: R318 (= R358), H369 (= H411), H376 (= H418), H414 (= H457)
- binding flavin-adenine dinucleotide: E200 (= E231), G201 (= G232), I206 (= I237), W322 (≠ F362), E413 (= E456), H414 (= H457), N450 (= N493)
- binding manganese (ii) ion: H369 (= H411), H376 (= H418), E413 (= E456)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
22% identity, 54% coverage: 5:494/914 of query aligns to 53:513/521 of Q8N465
- S109 (≠ L31) to W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- N127 (≠ T49) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (≠ A53) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (≠ E79) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (≠ K85) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (≠ A100) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (vs. gap) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (= A126) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (= A152) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G154) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
- D375 (≠ N347) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- R386 (= R358) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- T390 (≠ F362) binding ; binding ; mutation to A: Significantly reduced catalytic activity.
- V399 (= V375) to M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- K401 (≠ I377) binding ; binding ; mutation to A: Loss of catalytic activity.
- R419 (≠ T395) to H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- A426 (≠ G402) to T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- H434 (= H411) binding ; mutation to A: Loss of catalytic activity.
- G436 (≠ L413) to V: slight reduction in catalytic activity
- N439 (= N416) to D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- H441 (= H418) binding ; mutation to A: Loss of catalytic activity.
- N443 (≠ I420) binding ; mutation to A: Significantly reduced catalytic activity.
- V444 (≠ I421) to A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- A446 (≠ P423) to V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- E475 (= E456) binding ; mutation to A: Loss of catalytic activity.
- H476 (= H457) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- G477 (= G458) to R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
37% identity, 10% coverage: 411:500/914 of query aligns to 375:458/459 of P9WIT1
Sites not aligning to the query:
- 354 modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
8jdrA Crystal structure of h405a mldhd in complex with d-2-hydroxy-3-methyl- valeric acid (see paper)
23% identity, 33% coverage: 197:498/914 of query aligns to 179:456/456 of 8jdrA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147
8jdqA Crystal structure of h405a mldhd in complex with d-2-hydroxyisocaproic acid (see paper)
23% identity, 33% coverage: 197:498/914 of query aligns to 179:456/456 of 8jdqA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147
8jdoA Crystal structure of h405a mldhd in complex with d-2-hydroxyhexanoic acid (see paper)
23% identity, 33% coverage: 197:498/914 of query aligns to 179:456/456 of 8jdoA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147
8jdnA Crystal structure of h405a mldhd in complex with d-2-hydroxyvaleric acid (see paper)
23% identity, 33% coverage: 197:498/914 of query aligns to 179:456/456 of 8jdnA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147
8jdgA Crystal structure of h405a mldhd in complex with d-2-hydroxybutanoic acid (see paper)
23% identity, 33% coverage: 197:498/914 of query aligns to 179:456/456 of 8jdgA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147
8jdbA Crystal structure of h405a mldhd in complex with d-2-hydroxyoctanoic acid (see paper)
23% identity, 33% coverage: 197:498/914 of query aligns to 179:456/456 of 8jdbA
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 68, 70, 71, 72, 73, 74, 78, 79, 90, 132, 133, 134, 140, 141, 143, 144, 146, 147
- binding (2R)-2-oxidanyloctanoic acid: 75
Query Sequence
>200692 FitnessBrowser__MR1:200692
MTDDPVRRFAWSTDASYFRIVPEVVVHAETLEQVKLTLTVARKHNAPVTFRAAGTSLSGQ
AIGEGILLILGHDGFRKIEVSSDAKQITLGAAVIGSDANAVLAPLNRKIGPDPATIASAK
IGGIVANNASGMCCGTAQNSYQTIASAKLLFADGTELDTGCEKSKAEFAKTHGKLLQDLS
ELSHLTRHNSALAERIRKKYSIKNTTGYGINSLIDFTDPFDIINHLMVGMEGTLAFINEV
TYHTVNEAKFKASAMAVFHNMEDAARAIPLINGESVSAAELLDWPSIKAVTGKPGMPDWL
SELPALSAILLIESRADDAQTLEHYTQDVTAKLAGFDFIRPMEFSTNPAVYDKYWAMRKG
LFPIVGGERPKGTSVIIEDVAFELEHLAAAAHDITELFHKHGYPEGCIYGHALAGNFHFI
ITPAFTTQADIDRFHAFMDDIADMVINKYNGSMKAEHGTGRAVAPFVEKEWGQDAYTLMK
NIKQVFDPQGILNPGVILNDDSNIHVKNIKPCPVVDDFVDKCIECGFCEKTCPTSALNFS
PRQRIATLREIERLEQSGDKAAAAKMRADAKYDVIDTCAACQLCTIACPVDNSMGQLVRK
LRTPYISTTEQKVLDFQAKHFGAVNQVISTGFDVLGVIHKITGDGITNALMKTGRLISKE
VPYWNPDFPKGGKLPKPSPAKAGQETVVYFPACGGRTFGPTPKDPDNRTLPEVVVTLLER
AGYNVITPEKTRDLCCGQMWESKGDFKNADAKRQELIDVLSKMSNGGKIPVLVDALSCTY
RTLTGNPQVQITDLVEFMHDKLLDKLSINKKVNVALHLGCSARKMKLEPKMQAIANACSA
QVLKPAGIECCGYAGEKGLYKPEINASALRNIKKLIPVEVKEGYYANRMCEVGLTQHSGI
SYRHLAYLLEECSR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory